VDAC1 Rabbit Polyclonal Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human VDAC1 |
VDAC1 Rabbit Polyclonal Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human VDAC1 |
Rabbit polyclonal anti-VDAC1/Porin antibody, Loading control
Applications | IHC, WB |
Reactivities | Human, Monkey, Mouse, Dog |
Conjugation | Unconjugated |
Immunogen | Recombinant fragment corresponding to a region within amino acids 1 and 211 of VDAC1 (Uniprot ID#P21796) |
Rabbit Polyclonal Anti-VDAC2 antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-VDAC2 antibody: A synthesized peptide derived from human VDAC2 |
VDAC1 (N-term) rabbit polyclonal antibody, Purified
Applications | FC, IHC, WB |
Reactivities | Human, Mouse |
Immunogen | KLH conjugated synthetic peptide between 1-30 amino acids from the N-terminal region of human VDAC1. |
Rabbit polyclonal VDAC/Porin antibody
Applications | WB |
Conjugation | Unconjugated |
Immunogen | VDAC/Porin Antibody was prepared from whole rabbit serum produced by repeated immunizations with a synthetic peptide corresponding to amino acids 185-197 of Human VDAC1/Porin1. |
Rabbit Polyclonal Anti-VDAC2 Antibody
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-VDAC2 antibody: synthetic peptide directed towards the N terminal of human VDAC2. Synthetic peptide located within the following region: MATHGQTCARPMCIPPSYADLGKAARDIFNKGFGFGLVKLDVKTKSCSGV |
Rabbit Polyclonal Anti-VDAC3 Antibody
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-VDAC3 antibody: synthetic peptide directed towards the N terminal of human VDAC3. Synthetic peptide located within the following region: KWNTDNTLGTEISWENKLAEGLKLTLDTIFVPNTGKKSGKLKASYKRDCF |
Rabbit Polyclonal VDAC2/3 Antibody
Applications | WB |
Reactivities | Human, Bovine, Canine, Feline, Primate |
Conjugation | Unconjugated |
Immunogen | Amino acids 120-132 (KKSGKIKSSYKRE) of human VDAC2 protein were used as the immunogen. |
Rabbit Polyclonal Anti-VDAC2 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-VDAC2 antibody: synthetic peptide directed towards the N terminal of human VDAC2. Synthetic peptide located within the following region: VKLDVKTKSCSGVEFSTSGSSNTDTGKVTGTLETKYKWCEYGLTFTEKWN |
Rabbit Polyclonal Anti-VDAC3 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-VDAC3 antibody: synthetic peptide directed towards the N terminal of human VDAC3. Synthetic peptide located within the following region: SCSGVEFSTSGHAYTDTGKASGNLETKYKVCNYGLTFTQKWNTDNTLGTE |
Anti-VDAC1 Rabbit Polyclonal Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide corresponding to a region derived from 185-197 amino acids of human voltage-dependent anion channel 1 |
Anti-VDAC2 Rabbit Polyclonal Antibody
Applications | IHC |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide corresponding to a region derived from 283-294 amino acids of human voltage-dependent anion channel 2 |
Rabbit Polyclonal Anti-VDAC3 Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Full length fusion protein |
VDAC1 Antibody - C-terminal region
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen is a synthetic peptide directed towards the C terminal region of human VDAC1 |