Germany
Japan
United Kingdom
China
Primary Antibodies
View as table Download
Rabbit Polyclonal PPARGC1A Antibody
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | PPARGC1A antibody was raised against a 19 amino acid peptide near the carboxy terminus of human PPARGC1A. The immunogen is located within the last 50 amino acids of PPARGC1A. |
Rabbit Polyclonal Antibody against STAT3 (Phospho-STAT3-Y727 ) (Phospho-Specific)
| Applications | IF, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | This STAT3 Antibody is generated from rabbits immunized with a KLH conjugated synthetic phosphopeptide corresponding to amino acid residues surrounding S727 of human STAT3. |
| Modifications | Phospho-specific |
Anti-PRKCQ (Phospho-Ser676) Rabbit Polyclonal Antibody
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Peptide sequence around phosphorylation site of serine 676 (R-L-S(p)-F-A) derived from Human PKC?. |
| Modifications | Phospho-specific |
Rabbit polyclonal IKK-gamma (Ab-85) antibody
| Applications | IF, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized non-phosphopeptide derived from human IKK-? around the phosphorylation site of serine 85 (Q-A-SP-Q-R) |
IKK gamma (IKBKG) rabbit polyclonal antibody, Aff - Purified
| Applications | IF, IHC, WB |
| Reactivities | Human |
STAT3 (C-term) rabbit polyclonal antibody, Aff - Purified
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Immunogen | Synthetic peptide corresponding to a sequence at the C-terminal of human STAT3 |
Rabbit polyclonal antibody to IKK beta (inhibitor of kappa light polypeptide gene enhancer in B-cells, kinase beta)
| Applications | IF, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fragment corresponding to a region within amino acids 493 and 739 of IKK beta (Uniprot ID#O14920) |
Rabbit polyclonal IkB-beta (Ser23) antibody(Phospho-specific)
| Applications | IF, IHC, WB |
| Reactivities | Human: Ser23, Mouse: Ser23, Rat: Ser23 |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human I?B-β around the phosphorylation site of serine 23. |
| Modifications | Phospho-specific |
Rabbit polyclonal IkB-epsilon (Ab-22) antibody
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized non-phosphopeptide derived from human I?B-e around the phosphorylation site of serine 22 (I-E-SP-L-R). |
Anti-STAT3 (Phospho-Ser727) Rabbit Polyclonal Antibody
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Peptide sequence around phosphorylation site of serine 727 (P-M-S(p)-P-R) derived from Human STAT3. |
| Modifications | Phospho-specific |
Rabbit polyclonal Phospho-STAT3(S727) Antibody
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | This STAT3 Antibody is generated from rabbits immunized with a KLH conjugated synthetic phosphopeptide corresponding to amino acid residues surrounding S727 of human STAT3. |
| Modifications | Phospho-specific |
Rabbit Polyclonal anti-PPARGC1A antibody
| Applications | IF, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-PPARGC1A antibody: synthetic peptide directed towards the N terminal of human PPARGC1A. Synthetic peptide located within the following region: PSFDALTDGDVTTDNEASPSSMPDGTPPPQEAEEPSLLKKLLLAPANTQL |
PPAR alpha (PPARA) rabbit polyclonal antibody, Aff - Purified
| Applications | IF, WB |
| Reactivities | Human, Mouse, Rat |
NF-kB p65 (RELA) rabbit polyclonal antibody, Aff - Purified
| Applications | IF, WB |
| Reactivities | Human, Mouse |
Rabbit Polyclonal IKK beta Antibody
| Applications | IF, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | IKK beta antibody was raised against a peptide corresponding to amino acids near the carboxy-terminus of human IKK beta (Genbank accession NoO14920), which differs from corresponding murine sequence by one amino acid. |
Rabbit Polyclonal IKK gamma Antibody
| Applications | IF, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | IKK gamma antibody was raised against a 17 amino acid peptide near the carboxy terminus of human IKK gamma. The immunogen is located within the last 50 amino acids of IKK gamma. |
Rabbit polyclonal anti-NFkB p65 antibody
| Applications | IF, IHC |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This antibody was purified from whole rabbit serum prepared by repeated immunizations with the NFkB p65 peptide corresponding to the NLS of the human protein conjugated to KLH using maleimide. A residue of cysteine was added to the amino terminal end to facilitate coupling. |
Rabbit polyclonal NFKBp65 Antibody (C-term S536)
| Applications | IF, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This NFKBp65 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 517-539 amino acids from the C-terminal region of human NFKBp65. |
Rabbit polyclonal RELA Antibody (Center)
| Applications | IF, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This RELA antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 166-195 amino acids from the Central region of human RELA. |
IKK beta (IKBKB) rabbit polyclonal antibody, Aff - Purified
| Applications | IF |
| Reactivities | Human, Mouse, Rat |
| Immunogen | Synthesized non-phosphopeptide derived from human IKK-β around the phosphorylation site of tyrosine 199 (Q-K-YP-T-V) |
IKK beta (IKBKB) rabbit polyclonal antibody, Aff - Purified
| Applications | IF |
| Reactivities | Human, Mouse, Rat |
| Immunogen | Synthesized non-phosphopeptide derived from human IKK-β around the phosphorylation site of tyrosine 199 (Q-K-YP-T-V) |
Phospho-IKBKB-Y199 Rabbit Polyclonal Antibody
| Applications | IF |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | A phospho specific peptide corresponding to residues surrounding Y199 of human IKBKB |
| Modifications | Phospho-specific |
Active filters
Applications
- IF
Families
- Transcription Factors
Pathways
- Adipocytokine signaling pathway