Primary Antibodies

Jump to Filters

View as table

Loading...

Download Close

Download

1 - 26 of 26 results

(reset)

TNF alpha (TNF) Rabbit Polyclonal Antibody

AP20373PU-N

USD 370.00

In Stock

TNF alpha (TNF) rabbit polyclonal antibody, Aff - Purified

Applications	IF, IHC, WB
Reactivities	Human, Mouse, Rat
Immunogen	Synthetic peptide corresponding to amino acids 141-190 of Human TNF-α.

1 / 2

2 / 2

Previous Next

CaV1.3 (CACNA1D) Mouse Monoclonal Antibody [Clone ID: S48A-9]

TA309307

USD 410.00

In Stock

Mouse Monoclonal anti-CACNA1D Antibody

Applications	IF
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated

Integrin alpha 4 (ITGA4) Rabbit Polyclonal Antibody

TA306659

USD 430.00

In Stock

Rabbit Polyclonal Integrin alpha 4 Antibody

Applications	IF, WB
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated
Immunogen	Integrin alpha 4 antibody was raised against a 15 amino acid peptide from near the center of human Integrin alpha 4.

1 / 2

2 / 2

Previous Next

TNF alpha (TNF) Rabbit Polyclonal Antibody

TA313322

USD 345.00

In Stock

Rabbit polyclonal anti-TNFA antibody

Applications	IF, IHC
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated
Immunogen	The antiserum was produced against synthesized peptide derived from internal of human TNFA.

1 / 2

2 / 2

Previous Next

Integrin alpha 4 (ITGA4) (C-term) Rabbit Polyclonal Antibody

AP23259PU-N

USD 405.00

2 Weeks

Integrin alpha 4 (ITGA4) (C-term) rabbit polyclonal antibody, Aff - Purified

Applications	IF, IHC, IP, WB
Reactivities	Human, Mouse, Rat
Immunogen	Synthetic peptide corresponding to the C-terminal of human ITGA4

1 / 2

2 / 2

Previous Next

Integrin alpha 3 (ITGA3) (3A Isoform specific) Mouse Monoclonal Antibody [Clone ID: 29A3]

BM6022P

USD 390.00

2 Weeks

Integrin alpha 3 (ITGA3) (3A Isoform specific) mouse monoclonal antibody, clone 29A3, Purified

Applications	IF, IHC, WB
Reactivities	Human

Integrin alpha 3 (ITGA3) (3A Isoform specific) Mouse Monoclonal Antibody [Clone ID: 158A3]

BM6023P

USD 390.00

2 Weeks

Integrin alpha 3 (ITGA3) (3A Isoform specific) mouse monoclonal antibody, clone 158A3, Purified

Applications	IF, IHC, WB
Reactivities	Canine, Human

1 / 2

2 / 2

Previous Next

Integrin alpha 3 (ITGA3) (3B Isoform specific) Mouse Monoclonal Antibody [Clone ID: 54B3]

BM6025P

USD 390.00

2 Weeks

Integrin alpha 3 (ITGA3) (3B Isoform specific) mouse monoclonal antibody, clone 54B3, Purified

Applications	IF, IHC, WB
Reactivities	Human

CDX2 Rabbit Monoclonal Antibody [Clone ID: EPR2764Y]

AM10075SU-N

USD 550.00

5 Days

CDX2 rabbit monoclonal antibody, clone EPR2764Y, Supernatant

Applications	IF, IHC, WB
Reactivities	Human

Integrin alpha 6 (ITGA6) (1043-1072) Rabbit Polyclonal Antibody

AP22798PU-N

USD 440.00

2 Weeks

Integrin alpha 6 (ITGA6) (1043-1072) rabbit polyclonal antibody, Purified

Applications	IF, IHC, WB
Reactivities	Human
Immunogen	This ITGA6 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 1043-1072 amino acids from isoform 2 of human ITGA6. Epitope: aa 1043-1072

1 / 4

2 / 4

3 / 4

4 / 4

Previous Next

Integrin alpha 4 (ITGA4) Rabbit Polyclonal Antibody

AP22982PU-N

USD 440.00

2 Weeks

Integrin alpha 4 (ITGA4) rabbit polyclonal antibody, Purified

Applications	IF, IHC, WB
Reactivities	Human, Mouse, Rat
Immunogen	Synthetic peptide (GNSAGPKSMEVSC) from (C-term) of human NDRG1

1 / 2

2 / 2

Previous Next

Integrin alpha 6 (ITGA6) (6B Isoform specific) Mouse Monoclonal Antibody [Clone ID: 6B4]

BM6027P

USD 390.00

2 Weeks

Integrin alpha 6 (ITGA6) (6B Isoform specific) mouse monoclonal antibody, clone 6B4, Purified

Applications	IF, IHC, WB
Reactivities	Human

1 / 2

2 / 2

Previous Next

Emerin (EMD) Rabbit Polyclonal Antibody

TA306389

USD 430.00

5 Days

Rabbit Polyclonal Emerin Antibody

Applications	IF, IHC, WB
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated
Immunogen	Emerin antibody was raised against a 19 amino acid peptide from near the amino terminus of human Emerin.

1 / 3

2 / 3

3 / 3

Previous Next

CACNG6 Rabbit Polyclonal Antibody

TA324466

USD 450.00

5 Days

Rabbit polyclonal CACNG6 Antibody (Center)

Applications	IF, IHC, WB
Reactivities	Human
Conjugation	Unconjugated
Immunogen	This CACNG6 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 108-136 amino acids from the Central region of human CACNG6.

1 / 3

2 / 3

3 / 3

Previous Next

Integrin alpha 6 (ITGA6) Rabbit Polyclonal Antibody

TA324731

USD 450.00

5 Days

Rabbit polyclonal ITGA6 Antibody (isoform 2 S1064)

Applications	IF, IHC, WB
Reactivities	Human
Conjugation	Unconjugated
Immunogen	This ITGA6 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 1043-1072 amino acids from human ITGA6.

1 / 3

2 / 3

3 / 3

Previous Next

CD49b (ITGA2) Rabbit Polyclonal Antibody

TA338255

USD 375.00

5 Days

Rabbit Polyclonal Anti-ITGA2 Antibody

Applications	IF, WB
Reactivities	Human
Conjugation	Unconjugated
Immunogen	The immunogen for anti-ITGA2 antibody is: synthetic peptide directed towards the C-terminal region of Human ITGA2. Synthetic peptide located within the following region: LQNLQNQASLSFQALSESQEENKADNLVNLKIPLLYDAEIHLTRSTNINF

1 / 2

2 / 2

Previous Next

Integrin alpha 4 (ITGA4) Rabbit Polyclonal Antibody

TA306654

USD 430.00

5 Days

Rabbit Polyclonal Integrin alpha 4 Antibody

Applications	IF, WB
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated
Immunogen	Integrin alpha 4 antibody was raised against a 16 amino acid peptide from near the center of human Integrin alpha 4.

1 / 2

2 / 2

Previous Next

TNF alpha (TNF) Rabbit Polyclonal Antibody

TA336738

USD 479.00

5 Days

Rabbit Polyclonal TNF-alpha Antibody

Applications	IHC
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated
Immunogen	A synthetic peptide made to an internal portion of the human TNF alpha protein (between residues 100-200) [UniProt P01375]

1 / 4

2 / 4

3 / 4

4 / 4

Previous Next

TNF alpha (TNF) Mouse Monoclonal Antibody [Clone ID: OTI1C1]

CF506513

USD 465.00

In Stock

Carrier-free (BSA/glycerol-free) TNF mouse monoclonal antibody, clone OTI1C1 (formerly 1C1)

Applications	FC, IF, WB
Reactivities	Human
Conjugation	Unconjugated

• 

1 / 5

2 / 5

3 / 5

4 / 5

5 / 5

Previous Next

TNF alpha (TNF) Mouse Monoclonal Antibody [Clone ID: OTI5A11]

CF807821

USD 465.00

In Stock

Carrier-free (BSA/glycerol-free) TNFA mouse monoclonal antibody,clone OTI5A11

Applications	IF, WB
Reactivities	Human
Conjugation	Unconjugated

• 

1 / 2

2 / 2

Previous Next

TNF alpha (TNF) Mouse Monoclonal Antibody [Clone ID: OTI1C1]

TA506513

USD 379.00

In Stock

TNF mouse monoclonal antibody, clone OTI1C1 (formerly 1C1)

Applications	FC, IF, WB
Reactivities	Human
Conjugation	Unconjugated

• 

1 / 5

2 / 5

3 / 5

4 / 5

5 / 5

Previous Next

TNF alpha (TNF) Mouse Monoclonal Antibody [Clone ID: OTI1C1]

TA506513S

USD 159.00

2 Days

TNF mouse monoclonal antibody, clone OTI1C1 (formerly 1C1)

Applications	FC, IF, WB
Reactivities	Human
Conjugation	Unconjugated

• 

1 / 5

2 / 5

3 / 5

4 / 5

5 / 5

Previous Next

TNF alpha (TNF) Mouse Monoclonal Antibody [Clone ID: OTI5A11]

TA807821

USD 379.00

In Stock

TNFA mouse monoclonal antibody,clone OTI5A11

Applications	IF, WB
Reactivities	Human
Conjugation	Unconjugated

• 

1 / 2

2 / 2

Previous Next

TNF alpha (TNF) Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI5A11]

TA807821AM

USD 420.00

4 Weeks

TNFA mouse monoclonal antibody,clone OTI5A11, Biotinylated

Applications	IF, WB
Reactivities	Human
Conjugation	Biotin

• 

1 / 2

2 / 2

Previous Next

TNF alpha (TNF) Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI5A11]

TA807821BM

USD 420.00

4 Weeks

TNFA mouse monoclonal antibody,clone OTI5A11, HRP conjugated

Applications	IF, WB
Reactivities	Human
Conjugation	HRP

• 

1 / 2

2 / 2

Previous Next

TNF alpha (TNF) Mouse Monoclonal Antibody [Clone ID: OTI5A11]

TA807821S

USD 159.00

2 Days

TNFA mouse monoclonal antibody,clone OTI5A11

Applications	IF, WB
Reactivities	Human
Conjugation	Unconjugated

• 

1 / 2

2 / 2

Previous Next

1 - 26 of 26 results