Rabbit Monoclonal Antibody against MUC1 (Clone EP1024Y)
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Rabbit Monoclonal Antibody against MUC1 (Clone EP1024Y)
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Mouse Monoclonal MUC 1 Antibody
Applications | IHC |
Reactivities | Human |
Conjugation | Unconjugated |
EMA (MUC1) mouse monoclonal antibody, clone EMA-39, Purified
Applications | IF, IHC, IP |
Reactivities | Human |
Rabbit polyclonal CD227/MUC1 (Tyr1229) antibody(Phospho-specific)
Applications | IF, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human CD227/MUC1 around the phosphorylation site of tyrosine 1229 (S-P-YP-E-K) |
Modifications | Phospho-specific |
Rabbit Polyclonal MUC-1 Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat, Bovine, Equine, Guinea Pig, Porcine |
Conjugation | Unconjugated |
Immunogen | Synthetic peptides corresponding to MUC1(mucin 1, cell surface associated) The peptide sequence was selected from the C terminal region between aa 1200-1250 of human MUC1 (NP_001037855). Peptide sequence GQLDIFPARDTYHPMSEYPTYHTHGRYVPPSSTDRSPYEKVSAGNGGSSL. |
EMA (MUC1) mouse monoclonal antibody, clone n.a, Purified
Applications | ELISA, IHC |
Reactivities | Human |
EMA (MUC1) mouse monoclonal antibody, clone CM1, Ascites
Applications | IF, IHC |
Reactivities | Human |
EMA (MUC1) rabbit polyclonal antibody, Aff - Purified
Applications | IF, IHC |
Reactivities | Human, Mouse |
Rabbit polyclonal CD227/MUC1 antibody
Applications | IF, IHC |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from Internal of human CD227/MUC1. |
Carrier-free (BSA/glycerol-free) MUC1 mouse monoclonal antibody,clone OTI1F3
Applications | IF, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) MUC1 mouse monoclonal antibody, clone OTI2F6 (formerly 2F6)
Applications | IF, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) MUC1 mouse monoclonal antibody, clone OTI2E3 (formerly 2E3)
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) MUC1 mouse monoclonal antibody, clone OTI4A5 (formerly 4A5)
Applications | IF, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) MUC1 mouse monoclonal antibody, clone OTI3A7 (formerly 3A7)
Applications | IF, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Mouse Monoclonal EMA Antibody
Applications | IHC |
Reactivities | Human |
Conjugation | Unconjugated |
Rabbit Polyclonal Anti-MUC1 Antibody
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide of human MUC1 |
Rabbit Polyclonal Anti-MUC1 Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide of human MUC1 |
Rabbit Polyclonal Anti-MUC1(NT) Antibody
Applications | IHC |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide of human MUC1(NT) |
Rabbit Polyclonal Anti-MUC1(CT) Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide of human MUC1(CT) |
MUC1 mouse monoclonal antibody,clone OTI1F3
Applications | IF, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
USD 420.00
5 Days
MUC1 mouse monoclonal antibody,clone 1F3, Biotinylated
Applications | IF, IHC, WB |
Reactivities | Human |
Conjugation | Biotin |
USD 420.00
5 Days
MUC1 mouse monoclonal antibody,clone 1F3, HRP conjugated
Applications | IF, IHC, WB |
Reactivities | Human |
Conjugation | HRP |
MUC1 mouse monoclonal antibody,clone OTI1F3
Applications | IF, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Special Offer: Get this product for $99/€99. Use code: "Truesample".
MUC1 (EMA) mouse monoclonal antibody, clone OTI2F6 (formerly 2F6)
Applications | IF, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
USD 420.00
5 Days
MUC1 mouse monoclonal antibody,clone 2F6, Biotinylated
Applications | IF, IHC, WB |
Reactivities | Human |
Conjugation | Biotin |
USD 420.00
5 Days
MUC1 mouse monoclonal antibody,clone 2F6, HRP conjugated
Applications | IF, IHC, WB |
Reactivities | Human |
Conjugation | HRP |
MUC1 (EMA) mouse monoclonal antibody, clone OTI2F6 (formerly 2F6)
Applications | IF, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Special Offer: Get this product for $99/€99. Use code: "Truesample".
MUC1 (EMA) mouse monoclonal antibody, clone OTI2E3 (formerly 2E3)
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
USD 420.00
5 Days
MUC1 mouse monoclonal antibody,clone 2E3, Biotinylated
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Biotin |
USD 420.00
5 Days
MUC1 mouse monoclonal antibody,clone 2E3, HRP conjugated
Applications | IHC, WB |
Reactivities | Human |
Conjugation | HRP |
MUC1 (EMA) mouse monoclonal antibody, clone OTI2E3 (formerly 2E3)
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Special Offer: Get this product for $99/€99. Use code: "Truesample".
MUC1 (EMA) mouse monoclonal antibody, clone OTI4A5 (formerly 4A5)
Applications | IF, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
USD 420.00
5 Days
MUC1 mouse monoclonal antibody,clone 4A5, Biotinylated
Applications | IF, IHC, WB |
Reactivities | Human |
Conjugation | Biotin |
USD 420.00
5 Days
MUC1 mouse monoclonal antibody,clone 4A5, HRP conjugated
Applications | IF, IHC, WB |
Reactivities | Human |
Conjugation | HRP |
MUC1 (EMA) mouse monoclonal antibody, clone OTI4A5 (formerly 4A5)
Applications | IF, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Special Offer: Get this product for $99/€99. Use code: "Truesample".
MUC1 (EMA) mouse monoclonal antibody, clone OTI3A7 (formerly 3A7)
Applications | IF, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
USD 420.00
5 Days
MUC1 mouse monoclonal antibody,clone 3A7, Biotinylated
Applications | IF, IHC, WB |
Reactivities | Human |
Conjugation | Biotin |
USD 420.00
5 Days
MUC1 mouse monoclonal antibody,clone 3A7, HRP conjugated
Applications | IF, IHC, WB |
Reactivities | Human |
Conjugation | HRP |
MUC1 (EMA) mouse monoclonal antibody, clone OTI3A7 (formerly 3A7)
Applications | IF, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Special Offer: Get this product for $99/€99. Use code: "Truesample".
MUC1/EMA mouse monoclonal antibody,clone UMAB57
Applications | 10k-ChIP, IF, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) MUC1/EMA mouse monoclonal antibody,clone UMAB57
Applications | 10k-ChIP, IF, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
MUC1/EMA mouse monoclonal antibody,clone UMAB57
Applications | 10k-ChIP, IF, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Special Offer: Get this product for $99/€99. Use code: "Truesample".