Germany
Japan
United Kingdom
China
Primary Antibodies
View as table Download
Rabbit Polyclonal IFN-beta Antibody
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | IFN-beta antibody was raised against a 17 amino acid synthetic peptide from near the center of human IFN-b. The immunogen is located within amino acids 110 - 160 of IFN-beta. |
USD 380.00
In Stock
IL6 goat polyclonal antibody, Aff - Purified
| Applications | ELISA, FN, IHC, WB |
| Reactivities | Human |
| Immunogen | Highly pure (> 98%), 20.9 kDa E.coli derived recombinant Human IL-6 |
IL6 goat polyclonal antibody, Aff - Purified
| Applications | ELISA, FN, IHC, WB |
| Reactivities | Human |
| Immunogen | Highly pure (> 98%), 20.9 kDa E.coli derived recombinant Human IL-6 |
Rabbit Polyclonal Anti-IL33 Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-IL33 antibody: synthetic peptide directed towards the N terminal of human IL33. Synthetic peptide located within the following region: AKEVCPMYFMKLRSGLMIKKEACYFRRETTKRPSLKTGRKHKRHLVLAAC |
Anti-Human IL-33 Rabbit Polyclonal Antibody
| Applications | IHC |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | E.coli derived Recombinant Human IL-33 |
Rabbit Polyclonal Anti-IL6 Antibody (Internal)
| Applications | IHC |
| Reactivities | Human |
| Immunogen | IL6 antibody was raised against synthetic 16 amino acid peptide from internal region of human IL-6. Percent identity with other species by BLAST analysis: Human, Gorilla, Gibbon (100%); Monkey (88%). |
Rabbit Polyclonal Anti-IL6 Antibody (Internal)
| Applications | IHC |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | IL6 antibody was raised against synthetic 18 amino acid peptide from internal region of human IL-6. Percent identity with other species by BLAST analysis: Human, Gorilla, Monkey (100%); Gibbon (94%). |
Rabbit Polyclonal Anti-IFNA16 Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide of human IFNA16 |
Active filters
Applications
- IHC
Clonalities
- Polyclonal
Families
- Secreted Protein
Pathways
- Cytosolic DNA-sensing pathway