Rabbit anti-NLK Polyclonal Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human NLK |
Rabbit anti-NLK Polyclonal Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human NLK |
Rabbit polyclonal Catenin-beta (Tyr489) antibody(Phospho-specific)
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human Catenin-β around the phosphorylation site of tyrosine 489 (L-H-YP-G-L). |
Modifications | Phospho-specific |
Rabbit anti-SMAD4 Polyclonal Antibody
Applications | ICC/IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human SMAD4 |
Rabbit Polyclonal Anti-LEF1 Antibody
Applications | IHC |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Fusion protein of human LEF1 |
Rabbit Polyclonal antibody to NLK (nemo-like kinase)
Applications | IF, IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Recombinant fragment corresponding to a region within amino acids 234 and 527 of NLK (Uniprot ID#Q9UBE8) |
Rabbit polyclonal SMAD3-S208 Antibody
Applications | FC, IF, IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | This SMAD3 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 186-215 amino acids from human SMAD3. |
Rabbit polyclonal SMAD4 Antibody (C-term)
Applications | FC, IF, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | This SMAD4 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 400-428 amino acids from the C-terminal region of human SMAD4. |
Rabbit polyclonal Catenin-beta1 antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from internal of human Catenin-β1. |
Rabbit polyclonal anti-P300/CBP antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from human P300/CBP. |
Rabbit polyclonal SMAD3 phospho S423/phospho S425 antibody
Applications | IHC, WB |
Reactivities | Human, Zebrafish, Rat, Mouse, Swine, Bovine, Chicken |
Conjugation | Unconjugated |
Immunogen | This affinity purified antibody was prepared from whole rabbit serum produced by repeated immunizations with a synthetic peptide corresponding to amino acids 417-425 of human SMAD3 protein. |
Anti-SMAD3 (Phospho-Ser425) Rabbit Polyclonal Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Peptide sequence around phosphorylation site of serine 425 (C-S-S-V-S(p)) derived from Human Smad3. |
Modifications | Phospho-specific |
Rabbit polyclonal Smad3 (Ab-204) antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized non-phosphopeptide derived from human Smad3 around the phosphorylation site of serine 204 (A-G-SP-P-N). |
Rabbit polyclonal anti-p300 antibody
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from N-terminal of human p300. |
Rabbit polyclonal beta Catenin antibody
Applications | IHC, WB |
Reactivities | Bovine, Human, Mouse, Rat, Xenopus, Zebrafish |
Conjugation | Unconjugated |
Immunogen | beta catenin antibody was prepared from whole rabbit serum produced by repeated immunizations with a synthetic peptide corresponding to catenin beta-1 C-terminus. |
Rabbit Polyclonal Anti-LEF1 Antibody
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-LEF1 antibody: synthetic peptide directed towards the C terminal of human LEF1. Synthetic peptide located within the following region: VKPQHEQRKEQEPKRPHIKKPLNAFMLYMKEMRANVVAECTLKESAAINQ |
Rabbit Polyclonal Anti-SMAD4 Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-SMAD4 antibody: synthetic peptide directed towards the N terminal of human SMAD4. Synthetic peptide located within the following region: MDNMSITNTPTSNDACLSIVHSLMCHRQGGESETFAKRAIESLVKKLKEK |
Rabbit anti-SMAD3 (Phospho-Ser425) polyclonal antibody(Phospho-specific)
Applications | IHC |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antibody was produced against synthesized phosphopeptide derived from humanSmad3 around the phosphorylation site of serine 425 (C-S-S-V-SP). |
Modifications | Phospho-specific |
Rabbit polyclonal beta-Catenin (Ser37) antibody(Phospho-specific)
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human β-Catenin around the phosphorylation site of serine 37 (I-H-SP-G-A). |
Modifications | Phospho-specific |
Rabbit polyclonal anti-SMAD3 antibody
Applications | IHC, WB |
Reactivities | Human, Xenopus, Xenopus Tropicalis, Zebrafish, Rat, Mouse, Swine, Bovine, Chicken |
Conjugation | Unconjugated |
Immunogen | This affinity purified antibody was prepared from whole rabbit serum produced by repeated immunizations with a synthetic peptide corresponding to the C-terminal domain of human SMAD3 protein. |
Anti-SMAD2 Rabbit Polyclonal Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Peptide sequence around aa.218~222 (P-E-T-P-P) derived from Human Smad2. |
Anti-SMAD3 Rabbit Polyclonal Antibody
Applications | IF, IHC |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Peptide sequence around aa.423~427 (C-S-S-V-S) derived from Human Smad3. |
Rabbit Polyclonal anti-TCF7L1 antibody
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-TCF7L1 antibody: synthetic peptide directed towards the N terminal of human TCF7L1. Synthetic peptide located within the following region: NDELIPFQDEGGEEQEPSSDSASAQRDLDEVKSSLVNESENQSSSSDSEA |
Rabbit Polyclonal Smad2 Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat, Bovine, Canine, Chicken, Primate |
Conjugation | Unconjugated |
Immunogen | Amino acids 234-249 (DQQLNQSMDTGSPAEL) of human SMAD2 protein was used as the immunogen. |
Rabbit Polyclonal Anti-TCF7 Antibody
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-TCF7 antibody: synthetic peptide directed towards the middle region of human TCF7. Synthetic peptide located within the following region: PAAIPHPAIVPPSGKQELQPFDRNLKTQAESKAEKEAKKPTIKKPLNAFM |
Anti-SMAD4 Rabbit Polyclonal Antibody
Applications | ELISA, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Fusion protein corresponding to a region derived from 14-227 amino acids of Human Mothers against decapentaplegic homolog 4 |
Rabbit Polyclonal Anti-SMAD3 Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide of human SMAD3 |
Rabbit Polyclonal Anti-EP300 Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide of human EP300 |