Primary Antibodies

Jump to Filters

View as table

Loading...

Download Close

Download

1 - 50 of 208 results

Page 1 of 5

(reset)

CD13 (ANPEP) Rabbit Monoclonal Antibody [Clone ID: EPR4058]

TA307568

USD 520.00

In Stock

Rabbit monoclonal antibody against CD13(clone EPR4058)

Applications	IHC, WB
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated

1 / 12

2 / 12

3 / 12

4 / 12

5 / 12

6 / 12

7 / 12

8 / 12

9 / 12

10 / 12

11 / 12

12 / 12

Previous Next

CD13 (ANPEP) Rabbit Polyclonal Antibody

AP20647PU-N

USD 370.00

2 Weeks

CD13 (ANPEP) rabbit polyclonal antibody, Aff - Purified

Applications	IHC, WB
Reactivities	Human
Immunogen	Synthetic peptide, corresponding to amino acids 880-930 of Human CD13.

1 / 2

2 / 2

Previous Next

CD13 (ANPEP) Rabbit Polyclonal Antibody

TA332824

USD 275.00

3 Weeks

Rabbit anti-ANPEP Polyclonal Antibody

Applications	ICC/IF, IHC, WB
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated
Immunogen	Recombinant protein of human ANPEP

Aminoacylase 1 (ACY1) Mouse Monoclonal Antibody [Clone ID: 4F1-B7]

AM31144PU-N

USD 480.00

2 Weeks

Aminoacylase 1 (ACY1) mouse monoclonal antibody, clone 4F1-B7, Purified

Applications	ELISA, IF, IHC, IP, WB
Reactivities	Human

1 / 5

2 / 5

3 / 5

4 / 5

5 / 5

Previous Next

GGT1 Rabbit Polyclonal Antibody

TA327174

USD 275.00

3 Weeks

GGT1 Rabbit Polyclonal Antibody

Applications	IHC, WB
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated
Immunogen	Recombinant protein of human GGT1

GGT1 (381-471) Mouse Monoclonal Antibody [Clone ID: 1F9]

AM31063PU-N

USD 480.00

2 Weeks

GGT1 (381-471) mouse monoclonal antibody, clone 1F9, Purified

Applications	ELISA, IHC, IP, WB
Reactivities	Human, Mouse

1 / 2

2 / 2

Previous Next

CNDP1 (C-term) Rabbit Polyclonal Antibody

AP50983PU-N

USD 450.00

2 Weeks

CNDP1 (C-term) rabbit polyclonal antibody, Aff - Purified

Applications	FC, IHC, WB
Reactivities	Human
Immunogen	KLH conjugated synthetic peptide between 422~451 amino acids from the C-terminal region of human CNDP1

1 / 3

2 / 3

3 / 3

Previous Next

GFPT2 (Center) Rabbit Polyclonal Antibody

AP51823PU-N

USD 450.00

2 Weeks

GFPT2 (Center) rabbit polyclonal antibody, Aff - Purified

Applications	FC, IHC, WB
Reactivities	Human
Immunogen	KLH conjugated synthetic peptide between 181~210 amino acids from the Center region of human GFPT2 / GFAT2

1 / 3

2 / 3

3 / 3

Previous Next

Aminoacylase 1 (ACY1) Rabbit Polyclonal Antibody

TA308034

USD 415.00

5 Days

Rabbit polyclonal antibody to Aminoacylase-1 (aminoacylase 1)

Applications	IF, IHC, WB
Reactivities	Human
Conjugation	Unconjugated
Immunogen	Recombinant fragment corresponding to a region within amino acids 89 and 366 of Aminoacylase 1 (Uniprot ID#Q03154)

1 / 3

2 / 3

3 / 3

Previous Next

L Kynurenine Hydrolase (KYNU) Rabbit Polyclonal Antibody

TA308219

USD 415.00

5 Days

Rabbit Polyclonal antibody to KYNU (kynureninase (L-kynurenine hydrolase))

Applications	IHC, WB
Reactivities	Human
Conjugation	Unconjugated
Immunogen	Recombinant fragment corresponding to a region within amino acids 114 and 329 of KYNU (Uniprot ID#Q16719)

1 / 2

2 / 2

Previous Next

L Kynurenine Hydrolase (KYNU) Rabbit Polyclonal Antibody

TA338980

USD 375.00

5 Days

Rabbit Polyclonal Anti-KYNU Antibody

Applications	IHC, WB
Reactivities	Human
Conjugation	Unconjugated
Immunogen	The immunogen for anti-KYNU antibody: synthetic peptide directed towards the C terminal of human KYNU. Synthetic peptide located within the following region: LAHAVGNVELYLHDWGVDFACWCSYKYLNAGAGGIAGAFIHEKHAHTIKP

1 / 2

2 / 2

Previous Next

Monoacylglycerol Lipase (MGLL) Goat Polyclonal Antibody

TA302540

USD 375.00

5 Days

Goat Polyclonal Antibody against Monoglyceride Lipase

Applications	IHC, WB
Reactivities	Human
Conjugation	Unconjugated
Immunogen	Peptide with sequence C-QDLPHLVNADGQY, from the internal region (near N-Terminus) of the protein sequence according to NP_009214.1; NP_001003794.1.

1 / 3

2 / 3

3 / 3

Previous Next

GGT1 Rabbit Polyclonal Antibody

TA308190

USD 415.00

5 Days

Rabbit Polyclonal antibody to GGT1 (gamma-glutamyltransferase 1)

Applications	IHC, WB
Reactivities	Human, Mouse
Conjugation	Unconjugated
Immunogen	Recombinant fragment corresponding to a region within amino acids 1 and 226 of GGT1 (Uniprot ID#P19440)

1 / 3

2 / 3

3 / 3

Previous Next

GFPT1 Rabbit Polyclonal Antibody

TA341276

USD 425.00

2 Weeks

Rabbit Polyclonal Anti-GFPT1 Antibody (N-Terminus)

Applications	IHC
Reactivities	Human
Immunogen	GFPT1 / GFAT antibody was raised against synthetic 12 amino acid peptide from N-Terminus of human GFPT1. Percent identity with other species by BLAST analysis: Human, Chimpanzee, Gorilla, Orangutan, Gibbon, Monkey, Galago, Marmoset, Mouse, Rat, Elephant, Panda, Bovine, Dog, Bat, Horse, Pig, Opossum, Guinea pig, Zebra finch, Chicken (100%); Turkey, Platypus (92%).

1 / 2

2 / 2

Previous Next

GFPT1 Rabbit Polyclonal Antibody

TA341277

USD 425.00

5 Days

Rabbit Polyclonal Anti-GFPT1 Antibody (C-Terminus)

Applications	IHC
Reactivities	Human
Immunogen	GFPT1 / GFAT antibody was raised against synthetic 14 amino acid peptide from C-Terminus of human GFPT1. Percent identity with other species by BLAST analysis: Human, Chimpanzee, Gorilla, Orangutan, Gibbon, Monkey, Galago, Marmoset, Mouse, Rat, Elephant, Bovine, Horse, Pig, Opossum, Guinea pig (100%); Dog, Bat (93%); Turkey, Zebra finch, Chicken (86%).

1 / 4

2 / 4

3 / 4

4 / 4

Previous Next

CNDP1 Mouse Monoclonal Antibody [Clone ID: OTI2F8]

CF500448

USD 465.00

In Stock

Carrier-free (BSA/glycerol-free) CNDP1 mouse monoclonal antibody, clone OTI2F8 (formerly 2F8)

Applications	IHC, WB
Reactivities	Human
Conjugation	Unconjugated

• 

1 / 2

2 / 2

Previous Next

Leukotriene A4 hydrolase (LTA4H) Mouse Monoclonal Antibody [Clone ID: OTI9C5]

CF500636

USD 465.00

In Stock

Carrier-free (BSA/glycerol-free) LTA4H mouse monoclonal antibody, clone OTI9C5 (formerly 9C5)

Applications	IHC, IP, WB
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated

• 
• 

1 / 9

2 / 9

3 / 9

4 / 9

5 / 9

6 / 9

7 / 9

8 / 9

9 / 9

Previous Next

Leukotriene A4 hydrolase (LTA4H) Mouse Monoclonal Antibody [Clone ID: OTI5C10]

CF500637

USD 465.00

4 Weeks

Carrier-free (BSA/glycerol-free) LTA4H mouse monoclonal antibody, clone OTI5C10 (formerly 5C10)

Applications	IHC, IP, WB
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated

• 
• 

1 / 11

2 / 11

3 / 11

4 / 11

5 / 11

6 / 11

7 / 11

8 / 11

9 / 11

10 / 11

11 / 11

Previous Next

Leukotriene A4 hydrolase (LTA4H) Mouse Monoclonal Antibody [Clone ID: OTI9G8]

CF500642

USD 465.00

4 Weeks

Carrier-free (BSA/glycerol-free) LTA4H mouse monoclonal antibody, clone OTI9G8 (formerly 9G8)

Applications	FC, IF, IHC, WB
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated

• 

1 / 13

2 / 13

3 / 13

4 / 13

5 / 13

6 / 13

7 / 13

8 / 13

9 / 13

10 / 13

11 / 13

12 / 13

13 / 13

Previous Next

Leukotriene A4 hydrolase (LTA4H) Mouse Monoclonal Antibody [Clone ID: OTI7D11]

CF500643

USD 465.00

4 Weeks

Carrier-free (BSA/glycerol-free) LTA4H mouse monoclonal antibody, clone OTI7D11 (formerly 7D11)

Applications	FC, IF, IHC, IP, WB
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated

• 

1 / 19

2 / 19

3 / 19

4 / 19

5 / 19

6 / 19

7 / 19

8 / 19

9 / 19

10 / 19

11 / 19

12 / 19

13 / 19

14 / 19

15 / 19

16 / 19

17 / 19

18 / 19

19 / 19

Previous Next

Leukotriene A4 hydrolase (LTA4H) Mouse Monoclonal Antibody [Clone ID: OTI2C5]

CF500662

USD 465.00

4 Weeks

Carrier-free (BSA/glycerol-free) LTA4H mouse monoclonal antibody, clone OTI2C5 (formerly 2C5)

Applications	IHC, IP, WB
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated

• 

1 / 13

2 / 13

3 / 13

4 / 13

5 / 13

6 / 13

7 / 13

8 / 13

9 / 13

10 / 13

11 / 13

12 / 13

13 / 13

Previous Next

Leukotriene A4 hydrolase (LTA4H) Mouse Monoclonal Antibody [Clone ID: OTI6B5]

CF500663

USD 465.00

In Stock

Carrier-free (BSA/glycerol-free) LTA4H mouse monoclonal antibody, clone OTI6B5 (formerly 6B5)

Applications	FC, IHC, IP, WB
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated

• 
• 

1 / 10

2 / 10

3 / 10

4 / 10

5 / 10

6 / 10

7 / 10

8 / 10

9 / 10

10 / 10

Previous Next

Leukotriene A4 hydrolase (LTA4H) Mouse Monoclonal Antibody [Clone ID: OTI3C11]

CF500664

USD 465.00

In Stock

Carrier-free (BSA/glycerol-free) LTA4H mouse monoclonal antibody, clone OTI3C11 (formerly 3C11)

Applications	IHC, WB
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated

• 
• 

1 / 8

2 / 8

3 / 8

4 / 8

5 / 8

6 / 8

7 / 8

8 / 8

Previous Next

Leukotriene A4 hydrolase (LTA4H) Mouse Monoclonal Antibody [Clone ID: OTI8F4]

CF500665

USD 465.00

In Stock

Carrier-free (BSA/glycerol-free) LTA4H mouse monoclonal antibody, clone OTI8F4 (formerly 8F4)

Applications	IF, IHC, IP, WB
Reactivities	Human, Mouse, Rat, Dog
Conjugation	Unconjugated

• 
• 

1 / 7

2 / 7

3 / 7

4 / 7

5 / 7

6 / 7

7 / 7

Previous Next

Leukotriene A4 hydrolase (LTA4H) Mouse Monoclonal Antibody [Clone ID: OTI1E9]

CF500666

USD 465.00

4 Weeks

Carrier-free (BSA/glycerol-free) LTA4H mouse monoclonal antibody, clone OTI1E9 (formerly 1E9)

Applications	IHC, IP, WB
Reactivities	Human, Monkey, Mouse, Rat, Dog
Conjugation	Unconjugated

• 
• 

1 / 12

2 / 12

3 / 12

4 / 12

5 / 12

6 / 12

7 / 12

8 / 12

9 / 12

10 / 12

11 / 12

12 / 12

Previous Next

Leukotriene A4 hydrolase (LTA4H) Mouse Monoclonal Antibody [Clone ID: OTI2A9]

CF500671

USD 465.00

In Stock

Carrier-free (BSA/glycerol-free) LTA4H mouse monoclonal antibody, clone OTI2A9 (formerly 2A9)

Applications	IF, IHC, IP, WB
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated

• 
• 

1 / 15

2 / 15

3 / 15

4 / 15

5 / 15

6 / 15

7 / 15

8 / 15

9 / 15

10 / 15

11 / 15

12 / 15

13 / 15

14 / 15

15 / 15

Previous Next

Monoacylglycerol Lipase (MGLL) Mouse Monoclonal Antibody [Clone ID: OTI2B11]

CF502886

USD 465.00

4 Weeks

Carrier-free (BSA/glycerol-free) MGLL mouse monoclonal antibody, clone OTI2B11 (formerly 2B11)

Applications	FC, IF, IHC, WB
Reactivities	Human
Conjugation	Unconjugated

• 

1 / 12

2 / 12

3 / 12

4 / 12

5 / 12

6 / 12

7 / 12

8 / 12

9 / 12

10 / 12

11 / 12

12 / 12

Previous Next

Monoacylglycerol Lipase (MGLL) Mouse Monoclonal Antibody [Clone ID: OTI1A1]

CF502887

USD 465.00

4 Weeks

Carrier-free (BSA/glycerol-free) MGLL mouse monoclonal antibody, clone OTI1A1 (formerly 1A1)

Applications	FC, IHC, WB
Reactivities	Human
Conjugation	Unconjugated

• 

1 / 4

2 / 4

3 / 4

4 / 4

Previous Next

Monoacylglycerol Lipase (MGLL) Mouse Monoclonal Antibody [Clone ID: OTI1H2]

CF502888

USD 465.00

4 Weeks

Carrier-free (BSA/glycerol-free) MGLL mouse monoclonal antibody, clone OTI1H2 (formerly 1H2)

Applications	IHC, WB
Reactivities	Human
Conjugation	Unconjugated

• 

1 / 3

2 / 3

3 / 3

Previous Next

Monoacylglycerol Lipase (MGLL) Mouse Monoclonal Antibody [Clone ID: OTI1C6]

CF502889

USD 465.00

4 Weeks

Carrier-free (BSA/glycerol-free) MGLL mouse monoclonal antibody, clone OTI1C6 (formerly 1C6)

Applications	FC, IF, IHC, WB
Reactivities	Human
Conjugation	Unconjugated

• 

1 / 9

2 / 9

3 / 9

4 / 9

5 / 9

6 / 9

7 / 9

8 / 9

9 / 9

Previous Next

Monoacylglycerol Lipase (MGLL) Mouse Monoclonal Antibody [Clone ID: OTI2G8]

CF502890

USD 465.00

4 Weeks

Carrier-free (BSA/glycerol-free) MGLL mouse monoclonal antibody, clone OTI2G8 (formerly 2G8)

Applications	FC, IF, IHC, WB
Reactivities	Human
Conjugation	Unconjugated

• 

1 / 9

2 / 9

3 / 9

4 / 9

5 / 9

6 / 9

7 / 9

8 / 9

9 / 9

Previous Next

Monoacylglycerol Lipase (MGLL) Mouse Monoclonal Antibody [Clone ID: OTI2C9]

CF502931

USD 465.00

4 Weeks

Carrier-free (BSA/glycerol-free) MGLL mouse monoclonal antibody, clone OTI2C9 (formerly 2C9)

Applications	FC, IHC, WB
Reactivities	Human
Conjugation	Unconjugated

• 

1 / 3

2 / 3

3 / 3

Previous Next

Monoacylglycerol Lipase (MGLL) Mouse Monoclonal Antibody [Clone ID: OTI1H1]

CF502932

USD 465.00

4 Weeks

Carrier-free (BSA/glycerol-free) MGLL mouse monoclonal antibody, clone OTI1H1 (formerly 1H1)

Applications	FC, IF, IHC, WB
Reactivities	Human
Conjugation	Unconjugated

• 

1 / 21

2 / 21

3 / 21

4 / 21

5 / 21

6 / 21

7 / 21

8 / 21

9 / 21

10 / 21

11 / 21

12 / 21

13 / 21

14 / 21

15 / 21

16 / 21

17 / 21

18 / 21

19 / 21

20 / 21

21 / 21

Previous Next

Monoacylglycerol Lipase (MGLL) Mouse Monoclonal Antibody [Clone ID: OTI2B6]

CF502973

USD 465.00

4 Weeks

Carrier-free (BSA/glycerol-free) MGLL mouse monoclonal antibody, clone OTI 2B6 (formerly 2B6)

Applications	FC, IHC, WB
Reactivities	Human
Conjugation	Unconjugated

• 

1 / 3

2 / 3

3 / 3

Previous Next

Monoacylglycerol Lipase (MGLL) Mouse Monoclonal Antibody [Clone ID: OTI4D1]

CF503067

USD 465.00

4 Weeks

Carrier-free (BSA/glycerol-free) MGLL mouse monoclonal antibody, clone OTI4D1 (formerly 4D1)

Applications	FC, IF, IHC, WB
Reactivities	Human
Conjugation	Unconjugated

• 

1 / 12

2 / 12

3 / 12

4 / 12

5 / 12

6 / 12

7 / 12

8 / 12

9 / 12

10 / 12

11 / 12

12 / 12

Previous Next

Monoacylglycerol Lipase (MGLL) Mouse Monoclonal Antibody [Clone ID: OTI1B1]

CF503068

USD 465.00

4 Weeks

Carrier-free (BSA/glycerol-free) MGLL mouse monoclonal antibody, clone OTI1B1 (formerly 1B1)

Applications	IF, IHC, WB
Reactivities	Human
Conjugation	Unconjugated

• 

1 / 9

2 / 9

3 / 9

4 / 9

5 / 9

6 / 9

7 / 9

8 / 9

9 / 9

Previous Next

Aminoacylase 1 (ACY1) Mouse Monoclonal Antibody [Clone ID: OTI1D4]

CF503189

USD 465.00

4 Weeks

Carrier-free (BSA/glycerol-free) ACY1 mouse monoclonal antibody, clone OTI1D4 (formerly 1D4)

Applications	FC, IHC, WB
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated

• 

1 / 8

2 / 8

3 / 8

4 / 8

5 / 8

6 / 8

7 / 8

8 / 8

Previous Next

Aminoacylase 1 (ACY1) Mouse Monoclonal Antibody [Clone ID: OTI2D3]

CF503190

USD 465.00

4 Weeks

Carrier-free (BSA/glycerol-free) ACY1 mouse monoclonal antibody, clone OTI2D3 (formerly 2D3)

Applications	FC, IHC, WB
Reactivities	Human, Mouse, Rat, Dog
Conjugation	Unconjugated

• 

1 / 6

2 / 6

3 / 6

4 / 6

5 / 6

6 / 6

Previous Next

Aminoacylase 1 (ACY1) Mouse Monoclonal Antibody [Clone ID: OTI2F1]

CF503213

USD 465.00

4 Weeks

Carrier-free (BSA/glycerol-free) ACY1 mouse monoclonal antibody, clone OTI2F1 (formerly 2F1)

Applications	FC, IHC, WB
Reactivities	Human, Monkey, Mouse, Rat, Dog
Conjugation	Unconjugated

• 

1 / 12

2 / 12

3 / 12

4 / 12

5 / 12

6 / 12

7 / 12

8 / 12

9 / 12

10 / 12

11 / 12

12 / 12

Previous Next

Aminoacylase 1 (ACY1) Mouse Monoclonal Antibody [Clone ID: OTI1A12]

CF503226

USD 465.00

4 Weeks

Carrier-free (BSA/glycerol-free) ACY1 mouse monoclonal antibody, clone OTI1A12 (formerly 1A12)

Applications	FC, IHC, WB
Reactivities	Human, Mouse, Rat, Dog
Conjugation	Unconjugated

• 

1 / 6

2 / 6

3 / 6

4 / 6

5 / 6

6 / 6

Previous Next

Aminoacylase 1 (ACY1) Mouse Monoclonal Antibody [Clone ID: OTI1B12]

CF503227

USD 465.00

4 Weeks

Carrier-free (BSA/glycerol-free) ACY1 mouse monoclonal antibody, clone OTI1B12 (formerly 1B12)

Applications	FC, IHC, WB
Reactivities	Human, Mouse, Rat, Dog
Conjugation	Unconjugated

• 

1 / 6

2 / 6

3 / 6

4 / 6

5 / 6

6 / 6

Previous Next

Aminoacylase 1 (ACY1) Mouse Monoclonal Antibody [Clone ID: OTI16C1]

CF503228

USD 465.00

4 Weeks

Carrier-free (BSA/glycerol-free) ACY1 mouse monoclonal antibody, clone OTI16C1 (formerly 16C1)

Applications	FC, IHC, WB
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated

• 

1 / 4

2 / 4

3 / 4

4 / 4

Previous Next

Phosphoribosyl pyrophosphate amidotransferase (PPAT) Mouse Monoclonal Antibody [Clone ID: OTI1B11]

CF504706

USD 465.00

In Stock

Carrier-free (BSA/glycerol-free) PPAT mouse monoclonal antibody, clone OTI1B11 (formerly 1B11)

Applications	IHC, WB
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated

• 

1 / 9

2 / 9

3 / 9

4 / 9

5 / 9

6 / 9

7 / 9

8 / 9

9 / 9

Previous Next

Phosphoribosyl pyrophosphate amidotransferase (PPAT) Mouse Monoclonal Antibody [Clone ID: OTI1B8]

CF504769

USD 465.00

In Stock

Carrier-free (BSA/glycerol-free) PPAT mouse monoclonal antibody, clone OTI1B8 (formerly 1B8)

Applications	IHC, WB
Reactivities	Human, Monkey, Mouse, Rat, Dog
Conjugation	Unconjugated

• 

1 / 16

2 / 16

3 / 16

4 / 16

5 / 16

6 / 16

7 / 16

8 / 16

9 / 16

10 / 16

11 / 16

12 / 16

13 / 16

14 / 16

15 / 16

16 / 16

Previous Next

Ubiquinol Cytochrome C Reductase Core Protein I (UQCRC1) Mouse Monoclonal Antibody [Clone ID: OTI1G6]

CF800089

USD 465.00

In Stock

Carrier-free (BSA/glycerol-free) UQCRC1 mouse monoclonal antibody, clone OTI1G6 (formerly 1G6)

Applications	FC, IHC, WB
Reactivities	Human, Monkey, Mouse, Rat, Dog
Conjugation	Unconjugated

• 

1 / 11

2 / 11

3 / 11

4 / 11

5 / 11

6 / 11

7 / 11

8 / 11

9 / 11

10 / 11

11 / 11

Previous Next

L Kynurenine Hydrolase (KYNU) Mouse Monoclonal Antibody [Clone ID: OTI1H1]

CF803959

USD 465.00

4 Weeks

Carrier-free (BSA/glycerol-free) KYNU mouse monoclonal antibody, clone OTI1H1 (formerly 1H1)

Applications	IHC
Reactivities	Human, Rat
Conjugation	Unconjugated

• 

1 / 9

2 / 9

3 / 9

4 / 9

5 / 9

6 / 9

7 / 9

8 / 9

9 / 9

Previous Next

L Kynurenine Hydrolase (KYNU) Mouse Monoclonal Antibody [Clone ID: OTI5E4]

CF804063

USD 465.00

In Stock

Carrier-free (BSA/glycerol-free) KYNU mouse monoclonal antibody, clone OTI5E4 (formerly 5E4)

Applications	IHC, WB
Reactivities	Human, Rat
Conjugation	Unconjugated

• 

1 / 4

2 / 4

3 / 4

4 / 4

Previous Next

L Kynurenine Hydrolase (KYNU) Mouse Monoclonal Antibody [Clone ID: OTI1F1]

CF804120

USD 465.00

In Stock

Carrier-free (BSA/glycerol-free) KYNU mouse monoclonal antibody, clone OTI1F1 (formerly 1F1)

Applications	IHC, WB
Reactivities	Human, Rat
Conjugation	Unconjugated

• 

1 / 3

2 / 3

3 / 3

Previous Next

CD13 (ANPEP) Mouse Monoclonal Antibody [Clone ID: OTI2E4]

CF807395

USD 465.00

In Stock

Carrier-free (BSA/glycerol-free) ANPEP mouse monoclonal antibody, clone OTI2E4 (formerly 2E4)

Applications	IHC, WB
Reactivities	Human
Conjugation	Unconjugated

• 

1 / 14

2 / 14

3 / 14

4 / 14

5 / 14

6 / 14

7 / 14

8 / 14

9 / 14

10 / 14

11 / 14

12 / 14

13 / 14

14 / 14

Previous Next

CD13 (ANPEP) Mouse Monoclonal Antibody [Clone ID: OTI2F10]

CF807396

USD 465.00

In Stock

Carrier-free (BSA/glycerol-free) ANPEP mouse monoclonal antibody, clone OTI2F10 (formerly 2F10)

Applications	IHC, WB
Reactivities	Human
Conjugation	Unconjugated

• 

1 / 9

2 / 9

3 / 9

4 / 9

5 / 9

6 / 9

7 / 9

8 / 9

9 / 9

Previous Next

1 - 50 of 208 results

Page 1 of 5