Primary Antibodies

View as table Download

Rabbit anti-NFKBIB Polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant protein of human NFKBIB

SHP1 (PTPN6) mouse monoclonal antibody, clone PTY11, Purified

Applications ELISA, IF, IHC, WB
Reactivities Human
Conjugation Unconjugated

SHP1 (PTPN6) mouse monoclonal antibody, clone PTY15, Purified

Applications ELISA, IF, IHC, WB
Reactivities Human
Conjugation Unconjugated

Mouse Anti-Human PTPN6 / SHP-1 Monoclonal Antibody

Applications IHC
Reactivities Human
Conjugation Unconjugated

Anti-PAK1 Rabbit Polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region derived from 225-238 amino acids of Human p21 protein (Cdc42/Rac)-activated kinase

Rabbit polyclonal LCK Antibody (N-term)

Applications FC, IF, IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen This LCK antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 23-52 amino acids from the N-terminal region of human LCK.

Rabbit polyclonal PAK1 (Ab-204) antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized non-phosphopeptide derived from human PAK1 around the phosphorylation site of serine 204 (T-R-SP-V-I).

Rabbit polyclonal PAK1 (Phospho-Ser199) antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized phosphopeptide derived from human PAK1/2 around the phosphorylation site of serine 199 (T-K-SP-V-Y).
Modifications Phospho-specific

Rabbit polyclonal PAK1 (Phospho-Ser204) antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized phosphopeptide derived from human PAK1 around the phosphorylation site of serine 204 (T-R-SP-V-I).
Modifications Phospho-specific

Rabbit polyclonal PAK1/2 (Ab-199) antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized non-phosphopeptide derived from human PAK1/2 around the phosphorylation site of serine 199 (T-K-SP-V-Y).

PAK1 mouse monoclonal antibody, clone 1E11, Purified

Applications ELISA, IHC, WB
Reactivities Human

SHP1 (PTPN6) mouse monoclonal antibody, clone 14D5, Purified

Applications ELISA, IHC, WB
Reactivities Human

PAK1 rabbit polyclonal antibody, Aff - Purified

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat

Rabbit polyclonal IkB-beta (Ser23) antibody(Phospho-specific)

Applications IF, IHC, WB
Reactivities Human: Ser23, Mouse: Ser23, Rat: Ser23
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized phosphopeptide derived from human I?B-β around the phosphorylation site of serine 23.
Modifications Phospho-specific

Rabbit polyclonal PAK3 (Ser154) antibody(Phospho-specific)

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized phosphopeptide derived from human PAK3 around the phosphorylation site of serine 154 (Y-M-SP-F-T).
Modifications Phospho-specific

Anti-PAK1 (Phospho-Thr212) Rabbit Polyclonal Antibody

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Peptide sequence around phosphorylation site of threonine 212 (P-V-T(p)-P-T) derived from Human PAK1.
Modifications Phospho-specific

Rabbit polyclonal LCK Antibody (C-term)

Applications FC, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen This LCK antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 480-509 amino acids from the C-terminal region of human LCK.

Rabbit polyclonal PAK1/2/3 (Phospho-Thr423/402/421) antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized phosphopeptide derived from human PAK1/2/3 around the phosphorylation site of threonine 423/402/421 (R-S-TP-M-V).
Modifications Phospho-specific

PAK1 pThr423/402/421 rabbit polyclonal antibody, Aff - Purified

Applications IF, IHC
Reactivities Human, Mouse, Rat
Immunogen The antiserum was produced against synthesized phosphopeptide derived from human PAK1 around the phosphorylation site of threonine 423 (R-S-TP-M-V).

PAK1 pThr423/402/421 rabbit polyclonal antibody, Aff - Purified

Applications IF, IHC
Reactivities Human, Mouse, Rat
Immunogen The antiserum was produced against synthesized phosphopeptide derived from human PAK1 around the phosphorylation site of threonine 423 (R-S-TP-M-V).

PAK1 rabbit polyclonal antibody, Aff - Purified

Applications IF, IHC
Reactivities Human, Mouse, Rat
Immunogen The antiserum was produced against synthesized non-phosphopeptide derived from human PAK1around the phosphorylation site of threonine 423 (R-S-Tp-M-V).

PAK1 rabbit polyclonal antibody, Aff - Purified

Applications IF, IHC
Reactivities Human, Mouse, Rat
Immunogen The antiserum was produced against synthesized non-phosphopeptide derived from human PAK1around the phosphorylation site of threonine 423 (R-S-Tp-M-V).

PAK1 rabbit polyclonal antibody, Aff - Purified

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide, corresponding to amino acids 400-450 of Human PAK1.

PAK1 rabbit polyclonal antibody, Aff - Purified

Applications IHC, WB
Reactivities Human, Mouse, Rat

PAK1 rabbit polyclonal antibody, Aff - Purified

Applications IHC, WB
Reactivities Human, Mouse, Rat

PAK3 rabbit polyclonal antibody, Aff - Purified

Applications IHC, WB
Reactivities Human, Mouse, Rat

PAK1 (245-490) rabbit polyclonal antibody, Aff - Purified

Applications IHC, WB
Reactivities Human
Immunogen Recombinant protein fragment containing a sequence corresponding to a region within amino acids 245 and 490 of Human PAK1

Rabbit Polyclonal Anti-NFKBIB Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-NFKBIB Antibody: synthetic peptide directed towards the C terminal of human NFKBIB. Synthetic peptide located within the following region: MLRPNPILARLLRAHGAPEPEGEDEKSGPCSSSSDSDSGDEGDEYDDIVV

PAK1 rabbit polyclonal antibody, Aff - Purified

Applications IHC
Reactivities Human, Mouse, Rat

PAK1 pThr423/402 rabbit polyclonal antibody, Aff - Purified

Applications IHC
Reactivities Human, Mouse, Rat

Anti-NFKBIB (Phospho-Ser23) Rabbit Polyclonal Antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Peptide sequence around phosphorylation site of serine 23 (L-G-S(p)-L-G) derived from Human I?B-β.
Modifications Phospho-specific

Anti-PTPN6 Rabbit Polyclonal Antibody

Applications ELISA, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein corresponding to a region derived from 244-515 amino acids of human protein tyrosine phosphatase, non-receptor type 6

Anti-PAK1 Rabbit Polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region derived from 225-238 amino acids of Human p21 protein (Cdc42/Rac)-activated kinase

Rabbit Polyclonal Anti-PAK3 Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide of human PAK3