Rabbit anti-MAOB Polyclonal Antibody
Applications | ICC/IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human MAOB |
Rabbit anti-MAOB Polyclonal Antibody
Applications | ICC/IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human MAOB |
Rabbit polyclonal antibody to Dopamine beta-Hydroxylase (dopamine beta-hydroxylase (dopamine beta-monooxygenase))
Applications | IF, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Recombinant fragment corresponding to a region within amino acids 8 and 320 of Dopamine beta Hydroxylase (Uniprot ID#P09172) |
TYR Rabbit Polyclonal Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human TYR |
Tyrosinase (TYR) (C-term) rabbit polyclonal antibody, Purified
Applications | FC, IF, IHC, WB |
Reactivities | Human |
Immunogen | KLH conjugated synthetic peptide between 486-513 amino acids from the C-terminal region of Human Tyrosinase. |
Dopamine beta Hydroxylase (DBH) (N-term) rabbit polyclonal antibody, Aff - Purified
Applications | IF, IHC, WB |
Reactivities | Human |
Immunogen | KLH conjugated synthetic peptide between 27-56 amino acids from the N-terminal region of Human DBH. |
Monoamine Oxidase B / MAOB Goat Polyclonal (Internal) Antibody
Applications | IHC |
Reactivities | Gibbon, Bovine, Guinea pig, Gorilla, Horse, Human, Monkey, Orang-Utan, Pig, Rabbit |
Conjugation | Unconjugated |
Immunogen | MAOB / Monoamine Oxidase B antibody was raised against synthetic peptide C-HKARKLARLTKEE from an internal region of human MAOB (NP_000889.3). Percent identity by BLAST analysis: Human, Gorilla, Orangutan, Gibbon, Monkey, Marmoset, Elephant, Bovine, Rabbit, Horse, Pig, Opossum, Guinea pig (100%); Mouse, Rat, Panda, Dog (92%); Bat (85%). |
Anti-COMT Goat Polyclonal Antibody
Applications | IHC |
Reactivities | Gorilla, Human |
Conjugation | Unconjugated |
Immunogen | COMT antibody was raised against synthetic peptide GDTKEQRILNHVLQC from the N-terminus of human COMT (NP_000745.1; NP_001128633.1; NP_001128634.1; NP_009294.1). Percent identity by BLAST analysis: Human, Gorilla (100%); Gibbon, Monkey, Marmoset, Panda, Dog (93%); Hamster, Bat, Horse (86%). |
Rabbit Polyclonal Anti-TYRP1 Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-TYRP1 antibody: synthetic peptide directed towards the middle region of human TYRP1. Synthetic peptide located within the following region: NDPIFVLLHTFTDAVFDEWLRRYNADISTFPLENAPIGHNRQYNMVPFWP |
TRP2 (DCT) (N-term) rabbit polyclonal antibody, Purified
Applications | IHC, WB |
Reactivities | Human |
Immunogen | KLH conjugated synthetic peptide between 62-89 amino acids from the N-terminal region of human DCT. |
TRP2 (DCT) (N-term) rabbit polyclonal antibody, Aff - Purified
Applications | IHC, WB |
Reactivities | Human |
Immunogen | KLH conjugated synthetic peptide between 62-89 amino acids from the N-terminal region of Human DCT |
Goat Anti-AOC3 Antibody
Applications | IHC |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Peptide with sequence C-DEDPSFYSADSIY, from the internal region (near the C Terminus) of the protein sequence according to NP_003725.1. |
Rabbit polyclonal AOC3 Antibody (Center)
Applications | FC, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | This AOC3 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 613-640 amino acids from the Central region of human AOC3. |
Goat Polyclonal Antibody against thyroid peroxidase
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Peptide with sequence C-TRHVIQVSNEVVTDD, from the internal region of the protein sequence according to NP_000538.3; NP_783650.1; NP_783652.1; NP_783653.1. |
Rabbit Polyclonal Anti-MAOB Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | The immunogen for Anti-MAOB Antibody: synthetic peptide directed towards the N terminal of human MAOB. Synthetic peptide located within the following region: RDRVGGRTYTLRNQKVKYVDLGGSYVGPTQNRILRLAKELGLETYKVNEV |
Rabbit Polyclonal Anti-COMT Antibody (Internal)
Applications | IHC |
Reactivities | Human |
Immunogen | COMT antibody was raised against synthetic 19 amino acid peptide from internal region of human COMT. Percent identity with other species by BLAST analysis: Human, Gorilla (100%); Monkey (95%); Hamster, Rabbit (84%). |
Rabbit Polyclonal Anti-COMT Antibody (Internal)
Applications | IHC |
Reactivities | Human |
Immunogen | COMT antibody was raised against synthetic 15 amino acid peptide from internal region of human COMT. Percent identity with other species by BLAST analysis: Human, Gorilla (100%); Gibbon, Marmoset, Rabbit (93%); Horse (87%); Mouse, Rat, Hamster, Bat, Pig (80%). |
Rabbit Polyclonal Anti-COMT Antibody (N-Terminus)
Applications | IHC |
Reactivities | Human |
Immunogen | COMT antibody was raised against synthetic 19 amino acid peptide from N-terminus of human COMT. Percent identity with other species by BLAST analysis: Human, Gorilla (100%); Gibbon, Monkey (95%); Marmoset (89%); Hamster (84%). |
Rabbit Polyclonal Anti-COMT Antibody (Internal)
Applications | IHC |
Reactivities | Human |
Immunogen | COMT antibody was raised against synthetic 15 amino acid peptide from internal region of human COMT. Percent identity with other species by BLAST analysis: Human, Gorilla, Gibbon, Monkey, Marmoset, Mouse, Rat, Bat, Bovine, Pig (100%); Hamster, Elephant, Panda, Rabbit, Horse (93%); Dog, Turkey, Chicken, Xenopus (87%). |
Rabbit Polyclonal Anti-COMT Antibody (Internal)
Applications | IHC |
Reactivities | Human |
Immunogen | COMT antibody was raised against synthetic 19 amino acid peptide from internal region of human COMT. Percent identity with other species by BLAST analysis: Human, Chimpanzee, Gorilla (100%); Orangutan, Gibbon, Rabbit (95%); Monkey, Marmoset, Horse (89%); Mouse, Rat, Hamster (84%). |
Rabbit Polyclonal Anti-COMT Antibody (C-Terminus)
Applications | IHC |
Reactivities | Human |
Immunogen | COMT antibody was raised against synthetic 19 amino acid peptide from C-terminus of human COMT. Percent identity with other species by BLAST analysis: Human, Gorilla (100%); Monkey (95%); Hamster, Rabbit (84%). |
Carrier-free (BSA/glycerol-free) TYR mouse monoclonal antibody, clone OTI1F3 (formerly 1F3)
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Anti-TPO Rabbit Polyclonal Antibody
Applications | IHC |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Full length fusion protein |
Anti-TYR Rabbit Polyclonal Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Fusion protein corresponding to a region derived from 19-319 amino acids of human tyrosinase |
Anti-DCT Rabbit Polyclonal Antibody
Applications | ELISA, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Fusion protein corresponding to a region derived from 222-472 amino acids of human dopachrome tautomerase |
Anti-DCT Rabbit Polyclonal Antibody
Applications | IHC |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Fusion protein corresponding to a region derived from 222-472 amino acids of human dopachrome tautomerase |
Rabbit Polyclonal Anti-DBH Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Fusion protein of human DBH |
TYR mouse monoclonal antibody, clone OTI1F3 (formerly 1F3)
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
USD 420.00
5 Days
TYR mouse monoclonal antibody,clone 1F3, Biotinylated
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Biotin |
USD 420.00
5 Days
TYR mouse monoclonal antibody,clone 1F3, HRP conjugated
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | HRP |
TYR mouse monoclonal antibody, clone OTI1F3 (formerly 1F3)
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Special Offer: Get this product for $99/€99. Use code: "Truesample".
TYR (Tyrosinase) mouse monoclonal antibody,clone UMAB257
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) TYR (Tyrosinase) mouse monoclonal antibody,clone UMAB257
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
TYR (Tyrosinase) mouse monoclonal antibody,clone UMAB257
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Special Offer: Get this product for $99/€99. Use code: "Truesample".