Primary Antibodies

View as table Download

Rabbit Polyclonal Anti-DEPTOR Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen DEPTOR antibody was raised against a 16 amino acid peptide near the center of human DEPTOR.

Rabbit polyclonal anti-FAS antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from C-terminal of human Fas.

FAS Rabbit Polyclonal Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant protein of human FAS

Rabbit Polyclonal Fas Antibody

Applications ELISA, WB
Reactivities Human
Conjugation Unconjugated
Immunogen DNA immunization. This antibody is specific for the C Terminus Region of the target protein.

CD95 (FAS) rabbit polyclonal antibody, Aff - Purified

Applications IHC, WB
Reactivities Human, Mouse, Rat
Immunogen Synthetic peptide, corresponding to amino acids 280-330 of Human CD95.

SMURF 2 (SMURF2) (N-term) rabbit polyclonal antibody, Purified

Applications IHC, WB
Reactivities Human, Mouse
Immunogen This antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide selected from the N-terminal region of human SMURF2.

CD95 (FAS) (Center) rabbit polyclonal antibody

Applications WB
Reactivities Human
Immunogen conjugated synthetic peptide selected from the Center region of human FAS

CD95 (FAS) (323-327) rabbit polyclonal antibody, Aff - Purified

Applications WB
Reactivities Human
Immunogen Peptide sequence around aa.323~327 derived from human Fas .

CD95 (FAS) (323-327) rabbit polyclonal antibody, Aff - Purified

Applications WB
Reactivities Human
Immunogen Peptide sequence around aa.323~327 derived from human Fas .

Goat Anti-FAS / CD95 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Peptide with sequence KTCRKHRKENQGSH, from the internal region of the protein sequence according to NP_000034.1; NP_690610.1; NP_690611.1.

Rabbit Polyclonal Anti-FAIM2 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-FAIM2 antibody is: synthetic peptide directed towards the N-terminal region of Human FAIM2. Synthetic peptide located within the following region: QVHGEKKEAPAVPSAPPSYEEATSGEGMKAGAFPPAPTAVPLHPSWAYVD

Mouse Monoclonal FAS (C-terminus) Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) FAS mouse monoclonal antibody, clone OTI1F2 (formerly 1F2)

Applications WB
Reactivities Human
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) FAS mouse monoclonal antibody, clone OTI2C2 (formerly 2C2)

Applications WB
Reactivities Human
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) SMURF2 mouse monoclonal antibody, clone OTI6E12 (formerly 6E12)

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) SMURF2 mouse monoclonal antibody, clone OTI5E4 (formerly 5E4)

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) SMURF2 mouse monoclonal antibody, clone OTI3E4 (formerly 3E4)

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Anti-FAS Rabbit Polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein corresponding to a region derived from 156-335 amino acids of human Fas (TNF receptor superfamily, member 6)

FAS mouse monoclonal antibody, clone OTI1F2 (formerly 1F2)

Applications WB
Reactivities Human
Conjugation Unconjugated

FAS mouse monoclonal antibody, clone OTI1F2 (formerly 1F2)

Applications WB
Reactivities Human
Conjugation Unconjugated

FAS mouse monoclonal antibody, clone OTI2C2 (formerly 2C2)

Applications WB
Reactivities Human
Conjugation Unconjugated

FAS mouse monoclonal antibody, clone OTI2C2 (formerly 2C2)

Applications WB
Reactivities Human
Conjugation Unconjugated

SMURF2 mouse monoclonal antibody, clone OTI6E12 (formerly 6E12)

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

SMURF2 mouse monoclonal antibody, clone OTI6E12 (formerly 6E12)

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

SMURF2 mouse monoclonal antibody, clone OTI5E4 (formerly 5E4)

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

SMURF2 mouse monoclonal antibody, clone OTI5E4 (formerly 5E4)

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

SMURF2 mouse monoclonal antibody, clone OTI3E4 (formerly 3E4)

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

SMURF2 mouse monoclonal antibody, clone OTI3E4 (formerly 3E4)

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated