Primary Antibodies

View as table Download

PARP2 mouse monoclonal antibody, clone AT29G4, Purified

Applications ELISA, FC, IF, WB
Reactivities Human

PARP2 mouse monoclonal antibody, clone AT29G4, Purified

Applications ELISA, FC, IF, WB
Reactivities Human

PARP2 (389-401) goat polyclonal antibody, Aff - Purified

Applications ELISA, IHC, WB
Reactivities Human
Immunogen Synthetic peptide from an internal region of human PARP2

Goat Polyclonal Antibody against PARP2

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Peptide with sequence C-LDLFEVEKDGEKE, from the internal region of the protein sequence according to NP_005475.1.

Rabbit Polyclonal Anti-PARP2 Antibody

Applications IF, WB
Reactivities Rat
Conjugation Unconjugated
Immunogen The immunogen for anti-PARP2 antibody: synthetic peptide directed towards the middle region of human PARP2. Synthetic peptide located within the following region: LLDLFEVEKDGEKEAFREDLHNRMLLWHGSRMSNWVGILSHGLRIAHPEA

Rabbit polyclonal anti-PARP2 antibody

Applications WB
Reactivities Human Mouse
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human PARP2.

Parp2 (C-term) rabbit polyclonal antibody, Purified

Applications WB
Reactivities Human, Mouse
Immunogen KLH conjugated synthetic peptide between 313-344 amino acids from the C-terminal region of Human PARP2

Parp2 (N-term) rabbit polyclonal antibody, Aff - Purified

Applications WB
Reactivities Human, Mouse
Immunogen KLH conjugated synthetic peptide between 9-41 amino acids from the N-terminal region of human PARP2

Rabbit Polyclonal Anti-PARP2 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-PARP2 antibody is: synthetic peptide directed towards the C-terminal region of Human PARP2. Synthetic peptide located within the following region: QCNELLEANPKAEGLLQGKHSTKGLGKMAPSSAHFVTLNGSTVPLGPASD

PARP2 Antibody - middle region

Applications WB
Conjugation Unconjugated
Immunogen The immunogen is a synthetic peptide directed towards the middle region of mouse PARP2

PARP2 rabbit polyclonal antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Synthetic peptide of human PARP2

PARP2 Rabbit polyclonal Antibody

Applications WB
Reactivities Mouse, Rat
Conjugation Unconjugated
Immunogen A synthetic peptide corresponding to a sequence within amino acids 450-550 of human PARP2 (NP_001036083.1).
Modifications Unmodified