Primary Antibodies

View as table Download

Rabbit Polyclonal Rheb Antibody

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Rheb antibody was raised against a 15 amino acid peptide from the middle region of human Rheb.

RHEB Rabbit Polyclonal Antibody

Applications ICC/IF, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant protein of human RHEB

Rabbit Polyclonal Rheb Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Rabbit Rheb polyclonal antibody was raised against a 14 amino acid peptide from the amino terminus of human Rheb.

Rabbit polyclonal Anti-RHEB Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-RHEB antibody: synthetic peptide directed towards the middle region of human RHEB. Synthetic peptide located within the following region: VGKVQIPIMLVGNKKDLHMERVISYEEGKALAESWNAAFLESSAKENQTA

Anti-RHEB Rabbit Polyclonal Antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region derived from 150-162 amino acids of Human Ras homolog enriched in brain

Anti-RHEB Rabbit Polyclonal Antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region derived from 150-162 amino acids of Human Ras homolog enriched in brain

Rabbit Polyclonal Anti-RHEB Antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein of human RHEB

Rabbit Polyclonal Anti-RHEB Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide of human RHEB

RHEB rabbit polyclonal antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide of human RHEB

RHEB rabbit polyclonal antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein of human RHEB