Primary Antibodies

Jump to Filters

View as table

Loading...

Download Close

Download

1 - 38 of 38 results

(reset)

GSTA2 Rabbit Polyclonal Antibody

TA308025

USD 415.00

5 Days

Rabbit Polyclonal antibody to GSTA2 (glutathione S-transferase alpha 2)

Applications	IF, IHC, WB
Reactivities	Human
Conjugation	Unconjugated
Immunogen	Recombinant fragment corresponding to a region within amino acids 1 and 196 of GSTA2 (Uniprot ID#P09210)

1 / 3

2 / 3

3 / 3

Previous Next

CYP1B1 Rabbit Polyclonal Antibody

TA590005

USD 409.00

In Stock

Rabbit Polyclonal CYP1B1 Antibody

Applications	ELISA, WB
Reactivities	Human, Monkey, Mouse, Dog
Conjugation	Unconjugated
Immunogen	DNA immunization. This antibody is specific for the C Terminus Region of the target protein.

1 / 3

2 / 3

3 / 3

Previous Next

AKR1C1 Rabbit Polyclonal Antibody

TA342867

USD 375.00

5 Days

Rabbit Polyclonal Anti-AKR1C1 Antibody

Applications	WB
Reactivities	Human, Monkey
Conjugation	Unconjugated
Immunogen	The immunogen for anti-AKR1C1 antibody: synthetic peptide directed towards the N terminal of human AKR1C1. Synthetic peptide located within the following region: DSAHLYNNEEQVGLAIRSKIADGSVKREDIFYTSKLWCNSHRPELVRPAL

ADH1B Mouse Monoclonal Antibody [Clone ID: OTI5D7]

CF502778

USD 465.00

4 Weeks

Carrier-free (BSA/glycerol-free) ADH1B mouse monoclonal antibody, clone OTI5D7 (formerly 5D7)

Applications	FC, IF, IHC, WB
Reactivities	Human, Monkey
Conjugation	Unconjugated

• 

1 / 9

2 / 9

3 / 9

4 / 9

5 / 9

6 / 9

7 / 9

8 / 9

9 / 9

Previous Next

ALDH1A3 Mouse Monoclonal Antibody [Clone ID: OTI4B6]

CF502805

USD 465.00

In Stock

Carrier-free (BSA/glycerol-free) ALDH1A3 mouse monoclonal antibody, clone OTI4B6 (formerly 4B6)

Applications	FC, IHC, WB
Reactivities	Human, Monkey, Mouse, Rat, Dog
Conjugation	Unconjugated

• 

1 / 4

2 / 4

3 / 4

4 / 4

Previous Next

Cytochrome P450 2B6 (CYP2B6) Mouse Monoclonal Antibody [Clone ID: OTI3D5]

CF504328

USD 465.00

In Stock

Carrier-free (BSA/glycerol-free) CYP2B6 mouse monoclonal antibody, clone OTI3D5 (formerly 3D5)

Applications	FC, IF, IHC, WB
Reactivities	Human, Monkey, Mouse, Rat, Dog
Conjugation	Unconjugated

• 

1 / 14

2 / 14

3 / 14

4 / 14

5 / 14

6 / 14

7 / 14

8 / 14

9 / 14

10 / 14

11 / 14

12 / 14

13 / 14

14 / 14

Previous Next

Epoxide hydrolase (EPHX1) Mouse Monoclonal Antibody [Clone ID: OTI3A10]

CF800395

USD 465.00

In Stock

Carrier-free (BSA/glycerol-free) EPHX1 mouse monoclonal antibody, clone OTI3A10 (formerly 3A10)

Applications	IHC, WB
Reactivities	Human, Monkey
Conjugation	Unconjugated

• 

1 / 3

2 / 3

3 / 3

Previous Next

Epoxide hydrolase (EPHX1) Mouse Monoclonal Antibody [Clone ID: OTI3F10]

CF800407

USD 465.00

In Stock

Carrier-free (BSA/glycerol-free) EPHX1 mouse monoclonal antibody, clone OTI3F10 (formerly 3F10)

Applications	IHC, WB
Reactivities	Human, Monkey, Mouse, Rat
Conjugation	Unconjugated

• 

1 / 5

2 / 5

3 / 5

4 / 5

5 / 5

Previous Next

Epoxide hydrolase (EPHX1) Mouse Monoclonal Antibody [Clone ID: OTI3F11]

CF800418

USD 465.00

In Stock

Carrier-free (BSA/glycerol-free) EPHX1 mouse monoclonal antibody, clone OTI3F11 (formerly 3F11)

Applications	IHC, WB
Reactivities	Human, Monkey, Mouse, Dog
Conjugation	Unconjugated

• 

1 / 5

2 / 5

3 / 5

4 / 5

5 / 5

Previous Next

Epoxide hydrolase (EPHX1) Mouse Monoclonal Antibody [Clone ID: OTI2D8]

CF800439

USD 465.00

In Stock

Carrier-free (BSA/glycerol-free) EPHX1 mouse monoclonal antibody, clone OTI2D8 (formerly 2D8)

Applications	IHC, WB
Reactivities	Human, Monkey, Dog
Conjugation	Unconjugated

• 

1 / 4

2 / 4

3 / 4

4 / 4

Previous Next

ADH1B Mouse Monoclonal Antibody [Clone ID: OTI5D7]

TA502778

USD 379.00

In Stock

ADH1B mouse monoclonal antibody, clone OTI5D7 (formerly 5D7)

Applications	FC, IF, IHC, WB
Reactivities	Human, Monkey
Conjugation	Unconjugated

• 

1 / 9

2 / 9

3 / 9

4 / 9

5 / 9

6 / 9

7 / 9

8 / 9

9 / 9

Previous Next

ADH1B Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI5D7]

TA502778AM

USD 420.00

4 Weeks

ADH1B mouse monoclonal antibody, clone OTI5D7 (formerly 5D7), Biotinylated

Applications	FC, IF, IHC, WB
Reactivities	Human, Monkey
Conjugation	Biotin

• 

1 / 9

2 / 9

3 / 9

4 / 9

5 / 9

6 / 9

7 / 9

8 / 9

9 / 9

Previous Next

ADH1B Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI5D7]

TA502778BM

USD 420.00

4 Weeks

ADH1B mouse monoclonal antibody, clone OTI5D7 (formerly 5D7), HRP conjugated

Applications	FC, IF, IHC, WB
Reactivities	Human, Monkey
Conjugation	HRP

• 

1 / 9

2 / 9

3 / 9

4 / 9

5 / 9

6 / 9

7 / 9

8 / 9

9 / 9

Previous Next

ADH1B Mouse Monoclonal Antibody [Clone ID: OTI5D7]

TA502778S

USD 159.00

2 Days

ADH1B mouse monoclonal antibody, clone OTI5D7 (formerly 5D7)

Applications	FC, IF, IHC, WB
Reactivities	Human, Monkey
Conjugation	Unconjugated

• 

1 / 9

2 / 9

3 / 9

4 / 9

5 / 9

6 / 9

7 / 9

8 / 9

9 / 9

Previous Next

ALDH1A3 Mouse Monoclonal Antibody [Clone ID: OTI4B6]

TA502805

USD 379.00

In Stock

ALDH1A3 mouse monoclonal antibody, clone OTI4B6 (formerly 4B6)

Applications	FC, IHC, WB
Reactivities	Human, Monkey, Mouse, Rat, Dog
Conjugation	Unconjugated

• 

1 / 4

2 / 4

3 / 4

4 / 4

Previous Next

ALDH1A3 Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI4B6]

TA502805AM

USD 420.00

5 Days

ALDH1A3 mouse monoclonal antibody, clone 4B6, Biotinylated

Applications	FC, IHC, WB
Reactivities	Human, Monkey, Mouse, Rat, Dog
Conjugation	Biotin

• 

1 / 4

2 / 4

3 / 4

4 / 4

Previous Next

ALDH1A3 Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI4B6]

TA502805BM

USD 420.00

5 Days

ALDH1A3 mouse monoclonal antibody, clone 4B6, HRP conjugated

Applications	FC, IHC, WB
Reactivities	Human, Monkey, Mouse, Rat, Dog
Conjugation	HRP

• 

1 / 4

2 / 4

3 / 4

4 / 4

Previous Next

ALDH1A3 Mouse Monoclonal Antibody [Clone ID: OTI4B6]

TA502805S

USD 159.00

2 Days

ALDH1A3 mouse monoclonal antibody, clone OTI4B6 (formerly 4B6)

Applications	FC, IHC, WB
Reactivities	Human, Monkey, Mouse, Rat, Dog
Conjugation	Unconjugated

• 

1 / 4

2 / 4

3 / 4

4 / 4

Previous Next

Cytochrome P450 2B6 (CYP2B6) Mouse Monoclonal Antibody [Clone ID: OTI3D5]

TA504328

USD 379.00

In Stock

CYP2B6 (Cytochrome P450 2B6) mouse monoclonal antibody, clone OTI3D5 (formerly 3D5)

Applications	FC, IF, IHC, WB
Reactivities	Human, Monkey, Mouse, Rat, Dog
Conjugation	Unconjugated

• 

1 / 14

2 / 14

3 / 14

4 / 14

5 / 14

6 / 14

7 / 14

8 / 14

9 / 14

10 / 14

11 / 14

12 / 14

13 / 14

14 / 14

Previous Next

Cytochrome P450 2B6 (CYP2B6) Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI3D5]

TA504328AM

USD 420.00

4 Weeks

CYP2B6 (Cytochrome P450 2B6) mouse monoclonal antibody, clone OTI3D5 (formerly 3D5), Biotinylated

Applications	FC, IF, IHC, WB
Reactivities	Human, Monkey, Mouse, Rat, Dog
Conjugation	Biotin

• 

1 / 14

2 / 14

3 / 14

4 / 14

5 / 14

6 / 14

7 / 14

8 / 14

9 / 14

10 / 14

11 / 14

12 / 14

13 / 14

14 / 14

Previous Next

Cytochrome P450 2B6 (CYP2B6) Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI3D5]

TA504328BM

USD 420.00

4 Weeks

CYP2B6 (Cytochrome P450 2B6) mouse monoclonal antibody, clone OTI3D5 (formerly 3D5), HRP conjugated

Applications	FC, IF, IHC, WB
Reactivities	Human, Monkey, Mouse, Rat, Dog
Conjugation	HRP

• 

1 / 14

2 / 14

3 / 14

4 / 14

5 / 14

6 / 14

7 / 14

8 / 14

9 / 14

10 / 14

11 / 14

12 / 14

13 / 14

14 / 14

Previous Next

Cytochrome P450 2B6 (CYP2B6) Mouse Monoclonal Antibody [Clone ID: OTI3D5]

TA504328S

USD 159.00

In Stock

CYP2B6 (Cytochrome P450 2B6) mouse monoclonal antibody, clone OTI3D5 (formerly 3D5)

Applications	FC, IF, IHC, WB
Reactivities	Human, Monkey, Mouse, Rat, Dog
Conjugation	Unconjugated

• 

1 / 14

2 / 14

3 / 14

4 / 14

5 / 14

6 / 14

7 / 14

8 / 14

9 / 14

10 / 14

11 / 14

12 / 14

13 / 14

14 / 14

Previous Next

Epoxide hydrolase (EPHX1) Mouse Monoclonal Antibody [Clone ID: OTI3A10]

TA800395

USD 379.00

In Stock

EPHX1 (Epoxide Hydrolase 1) mouse monoclonal antibody, clone OTI3A10 (formerly 3A10)

Applications	IHC, WB
Reactivities	Human, Monkey
Conjugation	Unconjugated

• 

1 / 3

2 / 3

3 / 3

Previous Next

Epoxide hydrolase (EPHX1) Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI3A10]

TA800395AM

USD 420.00

5 Days

EPHX1 mouse monoclonal antibody,clone 3A10, Biotinylated

Applications	IHC, WB
Reactivities	Human, Monkey
Conjugation	Biotin

• 

1 / 3

2 / 3

3 / 3

Previous Next

Epoxide hydrolase (EPHX1) Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI3A10]

TA800395BM

USD 420.00

5 Days

EPHX1 mouse monoclonal antibody,clone 3A10, HRP conjugated

Applications	IHC, WB
Reactivities	Human, Monkey
Conjugation	HRP

• 

1 / 3

2 / 3

3 / 3

Previous Next

Epoxide hydrolase (EPHX1) Mouse Monoclonal Antibody [Clone ID: OTI3A10]

TA800395S

USD 159.00

2 Days

EPHX1 (Epoxide Hydrolase 1) mouse monoclonal antibody, clone OTI3A10 (formerly 3A10)

Applications	IHC, WB
Reactivities	Human, Monkey
Conjugation	Unconjugated

• 

1 / 3

2 / 3

3 / 3

Previous Next

Epoxide hydrolase (EPHX1) Mouse Monoclonal Antibody [Clone ID: OTI3F10]

TA800407

USD 379.00

In Stock

EPHX1 (Epoxide Hydrolase 1) mouse monoclonal antibody, clone OTI3F10 (formerly 3F10)

Applications	IHC, WB
Reactivities	Human, Monkey, Mouse, Rat
Conjugation	Unconjugated

• 

1 / 5

2 / 5

3 / 5

4 / 5

5 / 5

Previous Next

Epoxide hydrolase (EPHX1) Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI3F10]

TA800407AM

USD 420.00

5 Days

EPHX1 mouse monoclonal antibody,clone 3F10, Biotinylated

Applications	IHC, WB
Reactivities	Human, Monkey, Mouse, Rat
Conjugation	Biotin

• 

1 / 5

2 / 5

3 / 5

4 / 5

5 / 5

Previous Next

Epoxide hydrolase (EPHX1) Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI3F10]

TA800407BM

USD 420.00

5 Days

EPHX1 mouse monoclonal antibody,clone 3F10, HRP conjugated

Applications	IHC, WB
Reactivities	Human, Monkey, Mouse, Rat
Conjugation	HRP

• 

1 / 5

2 / 5

3 / 5

4 / 5

5 / 5

Previous Next

Epoxide hydrolase (EPHX1) Mouse Monoclonal Antibody [Clone ID: OTI3F10]

TA800407S

USD 159.00

2 Days

EPHX1 (Epoxide Hydrolase 1) mouse monoclonal antibody, clone OTI3F10 (formerly 3F10)

Applications	IHC, WB
Reactivities	Human, Monkey, Mouse, Rat
Conjugation	Unconjugated

• 

1 / 5

2 / 5

3 / 5

4 / 5

5 / 5

Previous Next

Epoxide hydrolase (EPHX1) Mouse Monoclonal Antibody [Clone ID: OTI3F11]

TA800418

USD 379.00

In Stock

EPHX1 (Epoxide Hydrolase 1) mouse monoclonal antibody, clone OTI3F11 (formerly 3F11)

Applications	IHC, WB
Reactivities	Human, Monkey, Mouse, Dog
Conjugation	Unconjugated

• 

1 / 5

2 / 5

3 / 5

4 / 5

5 / 5

Previous Next

Epoxide hydrolase (EPHX1) Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI3F11]

TA800418AM

USD 420.00

5 Days

EPHX1 mouse monoclonal antibody,clone 3F11, Biotinylated

Applications	IHC, WB
Reactivities	Human, Monkey, Mouse, Dog
Conjugation	Biotin

• 

1 / 5

2 / 5

3 / 5

4 / 5

5 / 5

Previous Next

Epoxide hydrolase (EPHX1) Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI3F11]

TA800418BM

USD 420.00

5 Days

EPHX1 mouse monoclonal antibody,clone 3F11, HRP conjugated

Applications	IHC, WB
Reactivities	Human, Monkey, Mouse, Dog
Conjugation	HRP

• 

1 / 5

2 / 5

3 / 5

4 / 5

5 / 5

Previous Next

Epoxide hydrolase (EPHX1) Mouse Monoclonal Antibody [Clone ID: OTI3F11]

TA800418S

USD 159.00

2 Days

EPHX1 (Epoxide Hydrolase 1) mouse monoclonal antibody, clone OTI3F11 (formerly 3F11)

Applications	IHC, WB
Reactivities	Human, Monkey, Mouse, Dog
Conjugation	Unconjugated

• 

1 / 5

2 / 5

3 / 5

4 / 5

5 / 5

Previous Next

Epoxide hydrolase (EPHX1) Mouse Monoclonal Antibody [Clone ID: OTI2D8]

TA800439

USD 379.00

In Stock

EPHX1 (Epoxide Hydrolase 1) mouse monoclonal antibody, clone OTI2D8 (formerly 2D8)

Applications	IHC, WB
Reactivities	Human, Monkey, Dog
Conjugation	Unconjugated

• 

1 / 4

2 / 4

3 / 4

4 / 4

Previous Next

Epoxide hydrolase (EPHX1) Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI2D8]

TA800439AM

USD 420.00

5 Days

EPHX1 mouse monoclonal antibody,clone 2D8, Biotinylated

Applications	IHC, WB
Reactivities	Human, Monkey, Dog
Conjugation	Biotin

• 

1 / 4

2 / 4

3 / 4

4 / 4

Previous Next

Epoxide hydrolase (EPHX1) Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI2D8]

TA800439BM

USD 420.00

5 Days

EPHX1 mouse monoclonal antibody,clone 2D8, HRP conjugated

Applications	IHC, WB
Reactivities	Human, Monkey, Dog
Conjugation	HRP

• 

1 / 4

2 / 4

3 / 4

4 / 4

Previous Next

Epoxide hydrolase (EPHX1) Mouse Monoclonal Antibody [Clone ID: OTI2D8]

TA800439S

USD 159.00

2 Days

EPHX1 (Epoxide Hydrolase 1) mouse monoclonal antibody, clone OTI2D8 (formerly 2D8)

Applications	IHC, WB
Reactivities	Human, Monkey, Dog
Conjugation	Unconjugated

• 

1 / 4

2 / 4

3 / 4

4 / 4

Previous Next

1 - 38 of 38 results