Primary Antibodies

View as table Download

CNP rabbit polyclonal antibody

Applications IHC, WB
Reactivities Human, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide of human CNP

Rabbit anti-CNP Polyclonal Antibody

Applications ICC/IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant protein of human CNP

Rabbit Polyclonal Anti-CNPase Antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-CNPase Antibody: Peptide sequence around aa.80~84 (M-V-S-A-D

CNPase (CNP) chicken polyclonal antibody, Aff - Purified

Applications IF, IHC, WB
Reactivities Human, Mouse
Immunogen Synthetic peptide KLH conjugated corresponded to a region of the CNPase gene product shared between the Human (NP_149124) and Mouse (P16330) sequences.
After repeated injections, immune eggs were collected, the IgY fractions were purified from the yolks.

CNPase (CNP) chicken polyclonal antibody

Applications IF, IHC
Reactivities Human, Mouse
Conjugation Unconjugated

rabbit Anti-CNP (2,3-cyclic nucleotide-3-phosphodiesterase) Antibody

Applications WB
Reactivities Human, Mouse, Rabbit, Rat, Sheep
Conjugation Unconjugated
Immunogen Endogenous rabbit 2,3 cyclic nucleotide-3-phospho-diesterase

CNPase (CNP) rabbit polyclonal antibody, Aff - Purified

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Rabbit Polyclonal Anti-CNP Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-CNP antibody: synthetic peptide directed towards the middle region of human CNP. Synthetic peptide located within the following region: LYSLGNGRWMLTLAKNMEVRAIFTGYYGKGKPVPTQGSRKGGALQSCTII

Rabbit Polyclonal Anti-CNP Antibody

Applications IP, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The immunogen for anti-CNP antibody: synthetic peptide directed towards the N terminal of human CNP. Synthetic peptide located within the following region: YKITPGARGAFSEEYKRLDEDLAAYCRRRDIRILVLDDTNHERERLEQLF

Rabbit Polyclonal CNPase Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Reacts with residues 68-84 of the 46-48 (doublet) kDa human, CNPase protein (74% sequence identity and 94% sequence similarity to mouse and rat).

Carrier-free (BSA/glycerol-free) CNP mouse monoclonal antibody,clone OTI3C3

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

CNP rabbit polyclonal antibody

Applications IHC, WB
Reactivities Human, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide of human CNP

CNP mouse monoclonal antibody,clone OTI3C3

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

CNP mouse monoclonal antibody,clone OTI3C3

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated