Primary Antibodies

View as table Download

Rabbit Polyclonal Anti-BDNF

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Peptide (C)VLEKVPVSKQLK, corresponding to amino acid residues 166-178 of human BDNF (precursor).

Rabbit Polyclonal Smad2/3 (Thr8) Antibody (Phospho-specific)

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against A synthesized peptide derived from human Smad2/3 around the phosphorylation site of Threonine 8
Modifications Phospho-specific

PAX3 Rabbit Polyclonal Antibody

Applications ICC/IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant protein of human PAX3

Rabbit Polyclonal Anti-BDNF Antibody

Applications IHC, WB
Reactivities Human, Macaque, Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-BDNF antibody: synthetic peptide directed towards the middle region of human BDNF. Synthetic peptide located within the following region: EWVTAADKKTAVDMSGGTVTVLEKVPVSKGQLKQYFYETKCNPMGYTKEG

Rabbit Polyclonal Anti-GRB7 Antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein of human GRB7

Rabbit Polyclonal Antibody against PROX1 (Center)

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen This PROX1 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 185-214 amino acids from the Central region of human PROX1.

Anti-POU5F1 Rabbit Polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein corresponding to a region derived from 1-150 amino acids of human POU class 5 homeobox 1

Rabbit Polyclonal Gli1 Antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen A synthetic peptide made to an internal portion of the human Gli1 protein (between residues 150-200) [UniProt P08151]

Goat Polyclonal Anti-BDNF Antibody

Applications IF, IHC
Reactivities Human, Mouse, Rat (Expected from sequence similarity: Dog)
Conjugation Unconjugated
Immunogen The immunogen for Anti-BDNF Antibody: Peptide with sequence ETKCNPMGYTKE, from the internal region of the protein sequence according to NP_001700.2; NP_001700.2; NP_733928.1; NP_733929.1; NP_733930.1; NP_733931.1.

Rabbit Polyclonal Anti-CDX2 Antibody

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen CDX2 antibody was raised against a 16 amino acid synthetic peptide near the carboxy terminus of human CDX2.

Rabbit anti-BDNF Polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant protein of human BDNF

Rabbit anti-CD44 Polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen A synthetic peptide of human CD44

Rabbit anti-CD9 Polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant protein of human CD9

Rabbit polyclonal Neuro D (Ser274) antibody(Phospho-specific)

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized phosphopeptide derived from human Neuro D around the phosphorylation site of serine 274 (P-L-SP-P-P).
Modifications Phospho-specific

Rabbit Polyclonal CD44 (Ser706) Antibody (Phospho-specific)

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against A synthesized peptide derived from human CD44 around the phosphorylation site of Serine 706
Modifications Phospho-specific

Rabbit Polyclonal Anti-proBDNF

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Peptide (C)DEDQKVRPNEENNKDAD, corresponding to amino acid residues 72-88 of human BDNF (precursor). Pro-domain of the BDNF protein.

Rabbit Polyclonal Antibody against SOX2 - Embryonic Stem Cell Marker

Applications FC, IHC, WB
Reactivities Human, Mouse, Sheep
Conjugation Unconjugated
Immunogen A synthetic peptide made to the N-terminal region of human SOX2 protein (within residues 1-100). [Swiss-Prot# P48431]

Rabbit polyclonal KLF5 Antibody (C-term)

Applications FC, IF, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen This KLF5 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 341-370 amino acids from the C-terminal region of human KLF5.

Rabbit polyclonal SMAD3-S208 Antibody

Applications FC, IF, IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen This SMAD3 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 186-215 amino acids from human SMAD3.

Rabbit Polyclonal DNMT3B Antibody

Applications ELISA, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-DNMT3B antibody: mouse DNMT3B (DNA methyltransferase 3B), using a KLH-conjugated synthetic peptide containing a sequence from the N-terminal part of the protein

Rabbit Polyclonal MYC Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against A synthesized peptide derived from human MYC

Rabbit Polyclonal Antibody against SOX2 (N-term)

Applications FC, IF, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen This SOX2 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 89-119 amino acids from the N-terminal region of human SOX2.

Rabbit polyclonal KLF4 Antibody (N-term C74)

Applications IF, IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen This KLF4 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 69-101 amino acids from the N-terminal region of human KLF4.

Rabbit anti-IGFBP1 Polyclonal Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen A synthetic peptide of human IGFBP1

Rabbit Polyclonal BMP-2 Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen A synthetic peptide made to an internal region of human BMP2 (within residues 250-350) [Swiss-Prot# P12643]

Rabbit Polyclonal KLF4 Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen KLF4 antibody was raised against a 20 amino acid peptide near the carboxy terminus of human KLF4.

Rabbit Polyclonal antibody to c-Myc (v-myc myelocytomatosis viral oncogene homolog (avian))

Applications Assay, FC, IF, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region within amino acids 1 and 52 of c-Myc (Uniprot ID#P01106)

Rabbit polyclonal SOX-9 (Ser181) antibody(Phospho-specific)

Applications IF, IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized phosphopeptide derived from human SOX-9 around the phosphorylation site of serine 181 (R-K-SP-V-K).
Modifications Phospho-specific

Anti-GDF3 Rabbit Polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein corresponding to a region derived from 251-364 amino acids of human growth differentiation factor 3

DNMT3B Rabbit Polyclonal Antibody

Applications ICC/IF, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen A synthetic peptide of human DNMT3B

Rabbit polyclonal Anti-DNMT3B Antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-DNMT3B antibody: synthetic peptide directed towards the middle region of human DNMT3B. Synthetic peptide located within the following region: GTGRLFFEFYHLLNYSRPKEGDDRPFFWMFENVVAMKVGDKRDISRFLEC

Rabbit Polyclonal NANOG Antibody

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen NANOG antibody was raised against a 19 amino acid peptide near the center of human NANOG.

Rabbit polyclonal CD44 (Ser706) antibody(Phospho-specific)

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized phosphopeptide derived from human CD44 around the phosphorylation site of serine 706 (S-K-SP-Q-E).
Modifications Phospho-specific

Rabbit polyclonal SMAD3 phospho S423/phospho S425 antibody

Applications IHC, WB
Reactivities Human, Zebrafish, Rat, Mouse, Swine, Bovine, Chicken
Conjugation Unconjugated
Immunogen This affinity purified antibody was prepared from whole rabbit serum produced by repeated immunizations with a synthetic peptide corresponding to amino acids 417-425 of human SMAD3 protein.

Anti-SMAD3 (Phospho-Ser425) Rabbit Polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Peptide sequence around phosphorylation site of serine 425 (C-S-S-V-S(p)) derived from Human Smad3.
Modifications Phospho-specific

Rabbit polyclonal PAX3 Antibody (N-term)

Applications FC, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen This PAX3 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 98-126 amino acids from the N-terminal region of human PAX3.

Rabbit polyclonal SMAD2 Antibody

Applications FC, IF, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen This SMAD2 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 97-125 amino acids from human SMAD2.

Rabbit Polyclonal SOX9 Antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The antiserum was produced against A synthesized peptide derived from human SOX9

Rabbit polyclonal OCT3 antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from human OCT3 antibody.

Rabbit polyclonal MYC antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from C-terminal of human Myc.

FGF10 Rabbit Polyclonal Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant protein of human FGF10

Rabbit anti-PDX1 Polyclonal Antibody

Applications WB
Reactivities Mouse
Conjugation Unconjugated
Immunogen A synthetic peptide of human PDX1

Rabbit Polyclonal anti-GLI2 antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-GLI2 antibody: synthetic peptide directed towards the N terminal of human GLI2. Synthetic peptide located within the following region: RNDVHLRTPLLKENGDSEAGTEPGGPESTEASSTSQAVEDCLHVRAIKTE

Rabbit anti-OTX2 Polyclonal Antibody

Applications WB
Reactivities Mouse
Conjugation Unconjugated
Immunogen Recombinant protein of human OTX2

Rabbit Polyclonal c-Myc Antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen A synthetic peptide made to the human c-Myc protein (between residues 400-450) [UniProt P01106]

Rabbit Polyclonal SOX9 Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat, Canine, Feline, Goat, Primate
Conjugation Unconjugated
Immunogen A portion of amino acids 225-275 of human SOX9 was used as the immunogen for this antibody.

Rabbit Polyclonal Anti-NODAL Antibody - N-terminal region

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-NODAL antibody: synthetic peptide directed towards the N terminal of human NODAL. Synthetic peptide located within the following region: PSSPSPLAYMLSLYRDPLPRADIIRSLQAEDVAVDGQNWTFAFDFSFLSQ

Rabbit Polyclonal Anti-Neuro D Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The immunogen for anti-Neuro D Antibody: A synthesized peptide derived from human Neuro D

Rabbit Polyclonal Anti-OCT3 Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The immunogen for anti-OCT3 Antibody: A synthesized peptide derived from human 41185

Rabbit Polyclonal Anti-MYC Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The immunogen for anti-MYC Antibody: A synthesized peptide derived from human MYC