Primary Antibodies

View as table Download

Rabbit polyclonal antibody to PLA2G3 (phospholipase A2, group III)

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Recombinant fragment corresponding to a region within amino acids 263 and 502 of PLA2G3 (Uniprot ID#Q9NZ20)

USD 300.00

In Stock

Goat Polyclonal Anti-VEGFA Antibody

Applications IF, WB
Reactivities Canine, Human, Monkey, Mouse, Rat
Conjugation Unconjugated
Immunogen Purified recombinant human VEGFA isoform 6 produced in E. coli.

Anti-VEGFA Rabbit Polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Immunogen Synthetic peptide corresponding to a region derived from 23-36 amino acids of human vascular endothelial growth factor A

Rabbit anti-VEGFA Polyclonal Antibody

Applications ICC/IF, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant protein of human VEGFA

Rabbit Polyclonal Anti-PLA2G5 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-PLA2G5 antibody: synthetic peptide directed towards the middle region of human PLA2G5. Synthetic peptide located within the following region: YRFAWGVVTCEPGPFCHVNLCACDRKLVYCLKRNLRSYNPQYQYFPNILC

Rabbit Polyclonal Anti-VEGF Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The immunogen for anti-VEGF Antibody: Synthetic peptide corresponding to a region derived human vascular endothelial growth factor A

PLA2G2D (C-term) rabbit polyclonal antibody, Aff - Purified

Applications FC, IHC, WB
Reactivities Human
Immunogen KLH conjugated synthetic peptide between 112-138 amino acids from the C-terminal region of human PLA2G2D

Rabbit Polyclonal Antibody against VEGFA

Applications WB
Reactivities Human, Mouse, Dog, Horse, Cow, Rat, Chicken, Guinea Pig
Conjugation Unconjugated
Immunogen A synthetic peptide made to an internal region of the human VEGFA protein sequence (between residues 150-250). [Swiss-Prot# P15692]

Rabbit Polyclonal Anti-PLA2G5 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-PLA2G5 antibody: synthetic peptide directed towards the N terminal of human PLA2G5. Synthetic peptide located within the following region: MKGLLPLAWFLACSVPAVQGGLLDLKSMIEKVTGKNALTNYGFYGCYCGW

Rabbit Polyclonal Antibody against VEGFA (N-term)

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen This VEGF1 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 66-95 amino acids from the N-terminal region of human VEGF1.

VEGFA (N-term) rabbit polyclonal antibody, Aff - Purified

Applications IHC, WB
Reactivities Human, Mouse, Rat
Immunogen A synthetic peptide corresponding to a sequence near the N-teminal end of VEGFA (aa 33-48 of Human origin.

PLA2G12A (Center) rabbit polyclonal antibody, Aff - Purified

Applications WB
Reactivities Human
Immunogen KLH conjugated synthetic peptide between 54-83 amino acids from the Central region of human PLA2G12A

Rabbit polyclonal antibody to Phospholipase A2 XIIA (phospholipase A2, group XIIA)

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region within amino acids 22 and 115 of PLA2G12A (Uniprot ID#Q9BZM1)

PLA2G5 (C-term) rabbit polyclonal antibody, Aff - Purified

Applications WB
Reactivities Human
Immunogen Synthetic peptide - KLH conjugated - corresponding to the C-terminal region (between 102-132aa) of human PLA2G5.

VEGFA (Center) rabbit polyclonal antibody, Aff - Purified

Applications WB
Reactivities Human
Immunogen KLH conjugated synthetic peptide between 147-176 amino acids from the Central region of human VEGFA

Goat Polyclonal Antibody against PLA2G1B

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Peptide with sequence NKAHKNLDTKKYCQS, from the C Terminus of the protein sequence according to NP_000919.1.

Goat Anti-VEGFA (aa288-299) Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Peptide with sequence C-RIKPHQGQHIGE, from the internal region of the protein sequence according to NP_001020537.2; NP_003367.4; NP_001020538.2; NP_001020539.2; etc..

PLA2G3 Rabbit Polyclonal (Internal) Antibody

Applications IHC
Reactivities Gibbon, Gorilla, Human
Immunogen PLA2G3 antibody was raised against synthetic 16 amino acid peptide from internal region of human PLA2G3. Percent identity with other species by BLAST analysis: Human, Gorilla, Gibbon, Monkey (100%); Marmoset, Mouse, Rat, Dog, Hamster (94%); Elephant, Panda, Rabbit (88%); Bovine, Horse, Pig (81%).

PLA2G3 Rabbit Polyclonal (Internal) Antibody

Applications IHC
Reactivities Gibbon, Bovine, Gorilla, Human, Monkey, Pig
Conjugation Unconjugated
Immunogen PLA2G3 antibody was raised against synthetic 12 amino acid peptide from internal region of human PLA2G3. Percent identity with other species by BLAST analysis: Human, Gorilla, Gibbon, Monkey, Marmoset, Bovine, Elephant, Panda, Pig (100%); Mouse, Horse, Rabbit (92%); Bat, Dog, Opossum (83%).

Anti-Human VEGF Goat Polyclonal Antibody

Applications IHC
Reactivities Human
Conjugation Unconjugated
Immunogen E.coli derived Recombinant Human VEGF

Anti-Human VEGF Rabbit Polyclonal Antibody

Applications IHC
Reactivities Human
Conjugation Unconjugated
Immunogen E.coli derived Recombinant Human VEGF

Rabbit Polyclonal Anti-PLA2G12B Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-PLA2G12B Antibody is: synthetic peptide directed towards the N-terminal region of Human PLA2G12B. Synthetic peptide located within the following region: LVLWLSLGGGLAQSDTSPDTEESYSDWGLRHLRGSFESVNSYFDSFLELL

Rabbit Polyclonal Anti-PLA2G3 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-PLA2G3 antibody is: synthetic peptide directed towards the C-terminal region of Human PLA2G3. Synthetic peptide located within the following region: QRRHQLQDKGTDERQPWPSEPLRGPMSFYNQCLQLTQAARRPDRQQKSWS

Rabbit Polyclonal Anti-PLA2G2E Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-PLA2G2E antibody: synthetic peptide directed towards the middle region of human PLA2G2E. Synthetic peptide located within the following region: GIFCAGRTTCQRLTCECDKRAALCFRRNLGTYNRKYAHYPNKLCTGPTPP

Anti-VEGFA Rabbit Polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region derived from 130-143 amino acids of human vascular endothelial growth factor A

Anti-VEGFA Rabbit Polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region derived from 130-143 amino acids of human vascular endothelial growth factor A