Germany
Japan
United Kingdom
China
Primary Antibodies
View as table Download
Rabbit Polyclonal anti-ATG4A antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-ATG4A antibody: synthetic peptide directed towards the N terminal of human ATG4A. Synthetic peptide located within the following region: DAGWGCMLRCGQMMLAQALICRHLGRDWSWEKQKEQPKEYQRILQCFLDR |
Rabbit Polyclonal anti-ATG4A antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-ATG4A antibody: synthetic peptide directed towards the middle region of human ATG4A. Synthetic peptide located within the following region: PQSLGALGGKPNNAYYFIGFLGDELIFLDPHTTQTFVDTEENGTVNDQTF |
Phospho-PRKAA1-T174/T172 Rabbit Polyclonal Antibody
| Applications | IHC |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | A phospho specific peptide corresponding to residues surrounding T174/T172 of human PRKAA1 |
| Modifications | Phospho-specific |
Rabbit Polyclonal Anti-IFNA7 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-IFNA7 Antibody: synthetic peptide directed towards the N terminal of human IFNA7. Synthetic peptide located within the following region: RALILLAQMGRISPFSCLKDRHEFRFPEEEFDGHQFQKTQAISVLHEMIQ |
Rabbit Polyclonal Anti-PIK3R4 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-PIK3R4 antibody: synthetic peptide directed towards the N terminal of human PIK3R4. Synthetic peptide located within the following region: HDLPEKAEGEPKENGLVILVSVITSCLQTLKYCDSKLAALELILHLAPRL |
Rabbit Polyclonal Anti-IFNA5 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-IFNA5 antibody: synthetic peptide directed towards the middle region of human IFNA5. Synthetic peptide located within the following region: TELYQQLNDLEACMMQEVGVEDTPLMNVDSILTVRKYFQRITLYLTEKKY |
Rabbit Polyclonal Anti-ATG4B Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-ATG4B Antibody: synthetic peptide directed towards the C terminal of human ATG4B. Synthetic peptide located within the following region: LGGALPMFELVELQPSHLACPDVLNLSLDSSDVERLERFFDSEDEDFEIL |
Rabbit Polyclonal Anti-ATG12 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-ATG12 Antibody: synthetic peptide directed towards the middle region of human ATG12. Synthetic peptide located within the following region: KFLKLVASEQLFIYVNQSFAPSPDQEVGTLYECFGSDGKLVLHYCKSQAW |
Rabbit Polyclonal Anti-ULK1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-ULK1 Antibody is: synthetic peptide directed towards the N-terminal region of Human ULK1. Synthetic peptide located within the following region: PEVIMSQHYDGKADLWSIGTIVYQCLTGKAPFQASSPQDLRLFYEKNKTL |
Rabbit Polyclonal GABARAP Antibody
| Applications | WB |
| Reactivities | Human, Rat |
| Conjugation | Unconjugated |
| Immunogen | N-terminus of GABAa Receptor Associated Protein (Proprietary) |
Rabbit Polyclonal GABARAP Antibody
| Applications | IHC |
| Reactivities | Mouse |
| Conjugation | Unconjugated |
| Immunogen | A synthetic peptide made to an N-terminal region of the human GABARAP protein (within residues 1-50). [Swiss-Prot O95166] |
Rabbit Polyclonal Anti-GABARAP
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-GABARAP antibody: synthetic peptide directed towards the N terminal of human GABARAP. Synthetic peptide located within the following region: KFVYKEEHPFEKRRSEGEKIRKKYPDRVPVIVEKAPKARIGDLDKKKYLV |
Rabbit Polyclonal Anti-GABARAP
| Applications | WB |
| Reactivities | Human, Manducasexta |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-GABARAP antibody: synthetic peptide directed towards the N terminal of human GABARAP. Synthetic peptide located within the following region: IRKKYPDRVPVIVEKAPKARIGDLDKKKYLVPSDLTVGQFYFLIRKRIHL |
Rabbit Polyclonal Anti-GABARAPL2 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-GABARAPL2 antibody: synthetic peptide directed towards the N terminal of human GABARAPL2. Synthetic peptide located within the following region: KWMFKEDHSLEHRCVESAKIRAKYPDRVPVIVEKVSGSQIVDIDKRKYLV |
Rabbit Polyclonal Anti-IFNA13 Antibody
| Applications | WB |
| Reactivities | Human |
| Immunogen | The immunogen for anti-IFNA13 antibody: synthetic peptide directed towards the C terminal of human IFNA13. Synthetic peptide located within the following region: ILAVKKYFRRITLYLTEKKYSPCAWEVVRAEIMRSLSLSTNLQERLRRKE |
Rabbit Polyclonal Anti-IFNA16 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-IFNA16 antibody is: synthetic peptide directed towards the C-terminal region of Human IFNA16. Synthetic peptide located within the following region: ILAVRKYFQRITLYLMGKKYSPCAWEVVRAEIMRSFSFSTNLQKGLRRKD |
Rabbit Polyclonal Anti-IFNA4 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-IFNA4 antibody is: synthetic peptide directed towards the C-terminal region of Human IFNA4. Synthetic peptide located within the following region: ILAVRKYFQRITLYLTEKKYSPCAWEVVRAEIMRSLSFSTNLQKRLRRKD |
Rabbit Polyclonal Anti-IFN-gamma Antibody
| Reactivities | Human, Rhesus Macaque |
| Conjugation | Unconjugated |
| Immunogen | For immunization recombinant human IFN-gamma (E.coli-derived) is used |
Rabbit Polyclonal Anti-IFN-gamma Antibody, Biotin conjugated
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | For immunization recombinant human IFN-gamma (E.coli-derived) is used |
Rabbit anti AMPKa(pS79) Polyclonal Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | A synthetic peptide surrounding to the epitope -CGSPN- with a phosphorylation site at Ser79 of AMPK alpha 1 protein from Carassius Auratus origin. This sequence is identical among human, mouse, rat, chicken, bovine, dog, and insect species. |
Rabbit anti AMPK-alpha(pT172) Polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Rat, Mouse, Bovine, Chicken, Dog |
| Conjugation | Unconjugated |
| Immunogen | A synthetic peptide surrounding to the epitope -LRTSC- with a phosphorylation site at Thr 172 of AMPK alpha protein from human origin |
Rabbit anti AMPK-alpha Polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Rat, Mouse, Bovine, Chicken, Dog |
| Conjugation | Unconjugated |
| Immunogen | A synthetic peptide surrounding to the epitope -LRTSC- with a phosphorylation site at Thr 172 of AMPK alpha protein from human origin |
Goat Anti-PRKAA2, Biotinylated Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence CPLDALNTTKP., from the internal region of the protein sequence according to NP_006243.2. |
Anti-BECN1 Rabbit Polyclonal Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide corresponding to a region derived from 50-65 amino acids of Human Beclin-1 |
Anti-APG4B Rabbit Polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide corresponding to a region derived from 5-20 amino acids of Human Autophagy-related protein 4 homolog B |
Anti-PRKAA2 Rabbit Polyclonal Antibody
| Applications | ELISA, IHC |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein corresponding to a region derived from 16-268 amino acids of human protein kinase, AMP-activated, alpha 2 catalytic subunit |
Anti-PRKAA2 Rabbit Polyclonal Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein corresponding to a region derived from 16-268 amino acids of human protein kinase, AMP-activated, alpha 2 catalytic subunit |
Rabbit Polyclonal Anti-ATG5 Antibody
| Applications | ELISA, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein of human ATG5 |
Rabbit Polyclonal Anti-ATG12 Antibody
| Applications | ELISA, IHC |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein of human ATG12 |
Rabbit Polyclonal Anti-ATG4D Antibody
| Applications | ELISA, IHC |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein of human ATG4D |
Rabbit Polyclonal Anti-INS Antibody
| Applications | IHC |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide of human INS |
Rabbit Polyclonal Anti-ATG4B Antibody
| Applications | IHC |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide of human ATG4B |
Rabbit Polyclonal Anti-ATG4A Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide of human ATG4A |
Rabbit Polyclonal Anti-IFNA16 Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide of human IFNA16 |
GABARAP Antibody - C-terminal region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen is a synthetic peptide directed towards the C terminal region of human GABARAP |
ULK3 Antibody - middle region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen is a synthetic peptide directed towards the middle region of human ULK3 |
ATG5 Antibody - middle region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen is a synthetic peptide directed towards the middle region of human ATG5 |
Active filters
Clonalities
- Polyclonal
Pathways
- Regulation of autophagy