Rabbit Polyclonal Anti-CACNB2 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-CACNB2 antibody: synthetic peptide directed towards the C terminal of human CACNB2. Synthetic peptide located within the following region: APHHNHRSGTSRGLSRQETFDSETQESRDSAYVEPKEDYSHDHVDHYASH |
Rabbit Polyclonal Anti-CACNB2 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-CACNB2 antibody: synthetic peptide directed towards the middle region of human CACNB2. Synthetic peptide located within the following region: ADISLAKRSVLNNPSKHAIIERSNTRSSLAEVQSEIERIFELARTLQLVV |
Rabbit Polyclonal Anti-CACNB2 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-CACNB2 antibody: synthetic peptide directed towards the middle region of human CACNB2. Synthetic peptide located within the following region: SRKSTPPSSGAKSADEQDQWKTAGLFWRFTTEHTPPYDVVPSMRPVVLVG |
Rabbit Polyclonal Anti-COX7B Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-COX7B antibody: synthetic peptide directed towards the N terminal of human COX7B. Synthetic peptide located within the following region: MFPLVKSALNRLQVRSIQQTMARQSHQKRTPDFHDKYGNAVLASGATFCI |
Rabbit Polyclonal Anti-CYC1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-CYC1 antibody: synthetic peptide directed towards the middle region of human CYC1. Synthetic peptide located within the following region: RWASEPEHDHRKRMGLKMLMMMALLVPLVYTIKRHKWSVLKSRKLAYRPP |
Rabbit Polyclonal Anti-CACNA1C Antibody (Internal)
| Applications | IHC |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | CACNA1C / Cav1.2 antibody was raised against synthetic 16 amino acid peptide from internal region of human CACNA1C / Cav1.2. Percent identity with other species by BLAST analysis: Human, Gibbon (100%); Gorilla, Monkey, Marmoset (94%). |
Rabbit Polyclonal Anti-CACNA1C Antibody (C-Terminus)
| Applications | IHC |
| Reactivities | Human |
| Immunogen | CACNA1C / Cav1.2 antibody was raised against synthetic 16 amino acid peptide from C-Terminus of human CACNA1C / Cav1.2. Percent identity with other species by BLAST analysis: Human, Gorilla, Monkey (100%); Marmoset (94%); Elephant (88%). |
Rabbit Polyclonal Anti-ATP1B3 Antibody (Internal)
| Applications | IHC |
| Reactivities | Human |
| Immunogen | ATP1B3 antibody was raised against synthetic 18 amino acid peptide from internal region of human ATP1B3. Percent identity with other species by BLAST analysis: Human, Monkey (100%); Gibbon (94%). |
Rabbit Polyclonal Anti-ATP1B3 Antibody (Internal)
| Applications | IHC |
| Reactivities | Human |
| Immunogen | ATP1B3 antibody was raised against synthetic 17 amino acid peptide from internal region of human ATP1B3. Percent identity with other species by BLAST analysis: Human, Gibbon, Monkey, Marmoset (100%); Guinea pig (94%); Rabbit, Lizard (88%); Elephant, Panda, Bat, Bovine, Dog, Horse, Pig, Turkey, Chicken, Xenopus (82%). |
Rabbit Polyclonal Anti-ATP1B3 Antibody (Internal)
| Applications | IHC |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | ATP1B3 antibody was raised against synthetic 18 amino acid peptide from internal region of human ATP1B3. Percent identity with other species by BLAST analysis: Human, Chimpanzee, Orangutan, Gibbon, Monkey, Marmoset, Mouse, Rat, Hamster, Panda, Dog, Bovine, Horse, Rabbit (100%); Elephant, Bat, Pig, Guinea pig (94%); Galago, Platypus (83%). |
Rabbit Polyclonal Anti-CACNB1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-CACNB1 antibody: synthetic peptide directed towards the C terminal of human CACNB1. Synthetic peptide located within the following region: RTMATAALAASPAPVSNLQVQVLTSLRRNLGFWGGLESSQRGSVVPQEQE |
Rabbit Polyclonal Anti-CACNB2 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-CACNB2 antibody: synthetic peptide directed towards the n terminal of human CACNB2. Synthetic peptide located within the following region: MNQGSGLDLLKISYGKGARRKNRFKGSDGSTSSDTTSNSFVRQGSADSYT |
Rabbit Polyclonal Anti-CACNB2 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-CACNB2 antibody: synthetic peptide directed towards the C terminal of human CACNB2. Synthetic peptide located within the following region: RQETFDSETQESRDSAYVEPKEDYSHDHVDHYASHRDHNHRDETHGSSDH |
Rabbit Polyclonal Anti-CACNB4 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-CACNB4 antibody: synthetic peptide directed towards the middle region of human CACNB4. Synthetic peptide located within the following region: FDGRISITRVTADISLAKRSVLNNPSKRAIIERSNTRISSLAEVQSEIERIF |
Rabbit Polyclonal Anti-CACNB2 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-CACNB2 antibody: synthetic peptide directed towards the n terminal of human CACNB2. Synthetic peptide located within the following region: IQMELLENVAPAGALGAAAQSYGKGARRKNRFKGSDGSTSSDTTSNSFVR |
Rabbit Polyclonal Anti-CACNA2D4 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-CACNA2D4 antibody: synthetic peptide directed towards the C terminal of human CACNA2D4. Synthetic peptide located within the following region: MAFLGTRAGLLRSSLFVGSEKVSDRKFLTPEDEASVFTLDRFPLWYRQAS |
Rabbit anti Troponin I Polyclonal Antibody
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | A synthetic peptide corresponding to inter-segment of human Troponin I Cardiac isoform protein. |
Anti-TPM2 Rabbit Polyclonal Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide corresponding to a region derived from 188-207 amino acids of Human tropomyosin 2 (beta) |
Anti-TPM2 Rabbit Polyclonal Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide corresponding to a region derived from 270-284 amino acids of human tropomyosin 2 (beta) |
Anti-TPM2 Rabbit Polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide corresponding to a region derived from 270-284 amino acids of human tropomyosin 2 (beta) |
Anti-COX5B Rabbit Polyclonal Antibody
| Applications | ELISA, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein corresponding to a region derived from 1-139 amino acids of human cytochrome c oxidase subunit Vb |
Anti-COX6B1 Rabbit Polyclonal Antibody
| Applications | ELISA, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Full length fusion protein |
Anti-COX7B Rabbit Polyclonal Antibody
| Applications | ELISA, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein corresponding to a region derived from 1-79 amino acids of human cytochrome c oxidase subunit VIIb |
Anti-ATP1A1 Rabbit Polyclonal Antibody
| Applications | IHC |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide corresponding to a region derived from 897-911 amino acids of human ATPase, Na+/K+ transporting, alpha 1 polypeptide |
Anti-ATP1A1 Rabbit Polyclonal Antibody
| Applications | IHC |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide corresponding to a region derived from 28-40 amino acids of human ATPase, Na+/K+ transporting, alpha 1 polypeptide |
Anti-TPM1 Rabbit Polyclonal Antibody
| Applications | ELISA, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Full length fusion protein |
Anti-TNNI3 rabbit polyclonal antibody
| Applications | ELISA, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Full length fusion protein |
Anti-MYH7 Rabbit Polyclonal Antibody
| Applications | ELISA, IHC |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein corresponding to a C terminal 300 amino acids of human myosin, heavy chain 7, cardiac muscle, beta |
Rabbit Polyclonal Anti-ATP1B2 Antibody
| Applications | IHC |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein of human ATP1B2 |
Rabbit Polyclonal Anti-MYL3 Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein of human MYL3 |
USD 345.00
In Stock
Rabbit Polyclonal Anti-UQCRC1 Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein of human UQCRC1 |
Rabbit Polyclonal Anti-CACNA1C Antibody
| Applications | IHC |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide of human CACNA1C |
ATP1A2 Antibody
| Conjugation | Unconjugated |
| Immunogen | The immunogen is a synthetic peptide directed towards the following sequence ISLAYEAAESDIMKRQPRNSQTDKLVNERLISMAYGQIGMIQALGGFFTY |
Germany
Japan
United Kingdom
China
