Rabbit anti-STAT1 (Phospho-Tyr701) polyclonal antibody (Phospho-specific)
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from humanSTAT1 around the phosphorylation site of tyrosine 701 (T-G-YP-I-K). |
| Modifications | Phospho-specific |
Rabbit anti-NF-kB p105/p50 (Phospho-Ser337) polyclonal antibody (Phospho-specific)
| Applications | IHC |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from humanNF-κB p105/p50 around the phosphorylation site of serine 337 (R-K-SP-D-L). |
| Modifications | Phospho-specific |
Phospho-RAC1-S71 Rabbit Polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | A phospho specific peptide corresponding to residues surrounding S71 of human RAC1 |
Rabbit polyclonal Bi-Phospho-ERK1/2(T202/Y204) Antibody
| Applications | Dot, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This ERK1/2 Antibody is generated from rabbits immunized with a KLH conjugated synthetic phosphopeptide corresponding to amino acid residues surrounding T202/Y204 of human ERK1/2. |
| Modifications | Phospho-specific |
Rabbit Polyclonal Smad2/3 (Thr8) Antibody (Phospho-specific)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against A synthesized peptide derived from human Smad2/3 around the phosphorylation site of Threonine 8 |
| Modifications | Phospho-specific |
Rabbit Polyclonal JNK1/2/3 (Thr183+Tyr185) Antibody (Phospho-specific)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against A synthesized peptide derived from human JNK1/2/3 around the phosphorylation site of Threonine 183+Tyrosine 185 |
| Modifications | Phospho-specific |
Rabbit anti-PGF Polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human PGF |
Rabbit anti-STAT3 (Phospho-Tyr705) polyclonal antibody (Phospho-specific)
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from humanSTAT3 around the phosphorylation site of tyrosine 705 (A-P-YP-L-K). |
| Modifications | Phospho-specific |
Rabbit Polyclonal antibody to RAC1 (ras-related C3 botulinum toxin substrate 1 (rho family, small GTP binding protein Rac1))
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fragment contain a sequence corresponding to a region within amino acids 1 and 196 of RAC1 (Uniprot ID#P63000 isoform B) |
Rabbit Polyclonal NF- kappaB p105/p50 (Ser932) Antibody (Phospho-specific)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against A synthesized peptide derived from human NF- kappaB p105/p50 around the phosphorylation site of Serine 932 |
| Modifications | Phospho-specific |
Anti-RAC2 Rabbit Polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein corresponding to a region derived from 50-192 amino acids of human ras-related C3 botulinum toxin substrate 2 (rho family, small GTP binding protein Rac2) |
Rabbit Polyclonal Anti-TGFR2 Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-TGFR2 Antibody: A synthesized peptide derived from human TGFR2 |
Rabbit Polyclonal Antibody against RAC1 (S71)
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This RAC1 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 49-78 amino acids from human RAC1. |
Rabbit polyclonal SMAD3-S208 Antibody
| Applications | FC, IF, IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | This SMAD3 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 186-215 amino acids from human SMAD3. |
Rabbit Polyclonal PI3-kinase p85- alpha (Tyr607) Antibody (Phospho-specific)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against A synthesized peptide derived from human PI3-kinase p85- alpha around the phosphorylation site of Tyrosine 607 |
| Modifications | Phospho-specific |
Rabbit anti-BAD (Phospho-Ser112) polyclonal antibody (Phospho-specific)
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from humanBAD around the phosphorylation site of serine 112 (H-S-SP-Y-P). |
| Modifications | Phospho-specific |
Rabbit polyclonal Caspase 9 (Tyr153) antibody(Phospho-specific)
| Applications | IF, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human Caspase 9 around the phosphorylation site of tyrosine 153 (L-A-YP-I-L). |
| Modifications | Phospho-specific |
Rabbit polyclonal Akt(Thr308) antibody(Phospho-specific)
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human Akt around the phosphorylation site of Threonine 308 (M-K-TP-F-C). |
| Modifications | Phospho-specific |
Rabbit polyclonal BRCA2 (Ser3291) antibody(Phospho-specific)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human BRCA2 around the phosphorylation site of serine 3291. |
| Modifications | Phospho-specific |
Rabbit Polyclonal JNK1/2/3 Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against A synthesized peptide derived from human JNK1/2/3 |
Rabbit Polyclonal Anti-MAPK10 Antibody - N-terminal region
| Applications | WB |
| Reactivities | Rat, Tobacco hornworm |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-Mapk10 antibody: synthetic peptide corresponding to a region of Rat. Synthetic peptide located within the following region: RYQNLKPIGSGAQGIVCAAYDAVLDRNVAIKKLSRPFQNQTHAKRAYREL |
Rabbit Polyclonal Antibody against PIK3R1 (N-term L11)
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This PI3KR1 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 1-30 amino acids from the N-terminal region of human PI3KR1. |
Rabbit anti-CDC42 Polyclonal Antibody
| Applications | ICC/IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human CDC42 |
Rabbit anti-AKT1 Polyclonal Antibody
| Applications | ICC/IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | A synthetic peptide of human AKT1 |
Phospho-BCL2L1-S62 Rabbit Polyclonal Antibody
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | A phospho specific peptide corresponding to residues surrounding S62 of human BCL2L1 |
| Modifications | Phospho-specific |
Rabbit Polyclonal Anti-RB1 Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein of human RB1 |
Rabbit anti-BAD (Phospho-Ser136) polyclonal antibody (Phospho-specific)
| Applications | IHC |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from mouse BAD around the phosphorylation site of serine136 (S-R-S[P]-A-P). |
| Modifications | Phospho-specific |
Rabbit polyclonal Raf1 (Ab-621) antibody
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized non-phosphopeptide derived from human RAF1 around the phosphorylation site of serine 621 (S-A-S-E-P). |
Rabbit polyclonal Akt (Ab-129) antibody
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized non-phosphopeptide derived from human Akt around the phosphorylation site of serine 129 (D-N-SP-G-A). |
Rabbit polyclonal Akt (Ab-326) antibody
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized non-phosphopeptide derived from human Akt around the phosphorylation site of tyrosine 326 (N-D-YP-G-R). |
Germany
Japan
United Kingdom
China
