Germany
Japan
United Kingdom
China
Primary Antibodies
View as table Download
Rabbit polyclonal EGFR (Ab-1172) antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized non-phosphopeptide derived from human EGFR around the phosphorylation site of tyrosine 1172 (P-D-YP-Q-Q). |
EGF mouse monoclonal antibody, clone S-21, Aff - Purified
| Applications | ELISA |
| Reactivities | Human |
| Conjugation | Unconjugated |
Rabbit Polyclonal Anti-WNT3A Antibody - C-terminal region
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-Wnt3a antibody: synthetic peptide corresponding to a region of Mouse. Synthetic peptide located within the following region: IGDFLKDKYDSASEMVVEKHRESRGWVETLRPRYTYFKVPTERDLVYYEA |
Rabbit Polyclonal Anti-WNT3A Antibody - N-terminal region
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-WNT3A antibody: synthetic peptide directed towards the N terminal of human WNT3A. Synthetic peptide located within the following region: MAPLGYFLLLCSLKQALGSYPIWWSLAVGPQYSSLGSQPILCASIPGLVP |
Goat Polyclonal Anti-Histone Deacetylase 1 Antibody
| Applications | WB |
| Reactivities | Human, Mouse (Expected from sequence similarity: Rat, Dog) |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-Histone Deacetylase 1 Antibody: Peptide with sequence C-KPEAKGVKEEVK, from the C Terminus of the protein sequence according to NP_004955.2. |
Rabbit polyclonal anti-Gli-3 antibody
| Applications | IF, IHC, WB |
| Reactivities | Human, Chimpanzee, Squirrel Monkey, Xenopus, Chicken, Dog |
| Conjugation | Unconjugated |
| Immunogen | This affinity purified antibody was produced from monospecific rabbit serum by repeated immunizations with a synthetic peptide corresponding to amino acids 41-57 of human Gli-3 protein. |
Rabbit Polyclonal Anti-WNT5A Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-WNT5A antibody: synthetic peptide directed towards the middle region of human WNT5A. Synthetic peptide located within the following region: GGCGDNIDYGYRFAKEFVDARERERIHAKGSYESARILMNLHNNEAGRRT |
EGF mouse monoclonal antibody, clone S-147, Aff - Purified
| Applications | ELISA |
| Reactivities | Human |
| Conjugation | Unconjugated |
Rabbit Polyclonal Anti-EGF Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-EGF antibody: synthetic peptide directed towards the middle region of human EGF. Synthetic peptide located within the following region: ITIDFLTDKLYWCDAKQSVIEMANLDGSKRRRLTQNDVGHPFAVAVFEDY |
Rabbit polyclonal EGFR (Thr693) antibody(Phospho-specific)
| Applications | IF, IHC, WB |
| Reactivities | Human: Thr693, Mouse: Thr695, Rat: Thr694 |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human EGFR around the phosphorylation site of threonine 693 (P-L-TP-P-S). |
| Modifications | Phospho-specific |
Rabbit polyclonal anti-Wnt-6 antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide surrounding amino acid 276 of mouse Wnt-6 |
Rabbit polyclonal anti-KGF/FGF-7 antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | E. coli expressed human KGF/FGF-7 |
Rabbit polyclonal anti-HDAC1 antibody, Loading control
| Applications | IF, WB |
| Reactivities | Human, Rat |
| Conjugation | Unconjugated |
| Immunogen | This HDAC1 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 70-99 amino acids from the N-terminal region of human HDAC1. |
FGF10 Rabbit Polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human FGF10 |
Rabbit Polyclonal anti-GLI2 antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-GLI2 antibody: synthetic peptide directed towards the N terminal of human GLI2. Synthetic peptide located within the following region: RNDVHLRTPLLKENGDSEAGTEPGGPESTEASSTSQAVEDCLHVRAIKTE |
Rabbit Polyclonal Anti-WNT7B Antibody
| Applications | IHC |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-WNT7B antibody: synthetic peptide directed towards the middle region of human WNT7B. Synthetic peptide located within the following region: WTTLPKFREVGHLLKEKYNAAVQVEVVRASRLRQPTFLRIKQLRSYQKPM |
Rabbit Polyclonal Anti-EGFR Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-EGFR Antibody: A synthesized peptide derived from human EGFR |
Rabbit Polyclonal Anti-EGF Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-EGF Antibody: A synthesized peptide derived from human EGF |
Rabbit Polyclonal Anti-HDAC1 Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | HDAC1 antibody was raised against a 19 amino acid peptide near the carboxy terminus of human HDAC1. |
purified EGFR Capture mouse monoclonal antibody, Luminex validated, clone OTI1B10
| Applications | LMNX |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Matched ELISA Pair | TA700469 |
purified EGFR Capture mouse monoclonal antibody, Luminex validated, clone OTI2E1
| Applications | LMNX |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Matched ELISA Pair | TA700471 |
purified EGFR Capture mouse monoclonal antibody, Luminex validated, clone OTI3D7
| Applications | LMNX |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Matched ELISA Pair | TA700469 |
purified EGFR Capture mouse monoclonal antibody, Luminex validated, clone OTI3F2
| Applications | LMNX |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Matched ELISA Pair | TA700472 |
purified EGFR Capture mouse monoclonal antibody, Luminex validated, clone OTI11H7
| Applications | LMNX |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Matched ELISA Pair | TA700473 |
Goat Polyclonal Anti-ERBB1 Antibody
| Applications | WB |
| Reactivities | Canine, Human, Monkey, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Purified recombinant peptide derived from within residues 1,162 aa to the C-terminus of human ERBB1 produced in E. coli. |
Rabbit polyclonal EGFR (Tyr1172) antibody(Phospho-specific)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human EGFR around the phosphorylation site of tyrosine 1172 (P-D-YP-Q-Q). |
| Modifications | Phospho-specific |
Rabbit polyclonal anti-WNT1 antibody
| Applications | IHC |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from Internal of human WNT1. |
Rabbit polyclonal anti-EGFR antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | This whole rabbit serum was prepared by repeated immunizations with a peptide synthesized using conventional technology. The sequence of the epitope maps to a region near the carboxy terminus which is identical in human, mouse and rat EGFR. |
Rabbit polyclonal anti-HDAC-1 antibody
| Applications | IF, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Anti-HDAC-1 antibody was prepared from whole rabbit serum produced by repeated immunizations with a synthetic peptide corresponding to amino acids 466-482 of Human HDAC-1. |
Anti-WNT5A Rabbit Polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein corresponding to C terminal 280 amino acids of human wingless-type MMTV integration site family, member 5A |
Rabbit polyclonal EGFR-S1026 Antibody (C-term)
| Applications | FC, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This EGFR-S1026 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 1004-1033 amino acids from the C-terminal region of human EGFR-S1026. |
Rabbit Polyclonal EGFR Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against A synthesized peptide derived from human EGFR |
Rabbit Polyclonal EGFR Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against A synthesized peptide derived from human EGFR |
Active filters
Conjugates
- Unconjugated
Families
- Adult stem cells
Pathways
- Pathways in cancer