Germany
Japan
United Kingdom
China
Primary Antibodies
View as table Download
Rabbit polyclonal anti-DELTA-4 antibody
| Applications | IHC, WB |
| Reactivities | Human, partial reactivity to Mouse and Rat |
| Conjugation | Unconjugated |
| Immunogen | Anti-DELTA-4 antibody was prepared from whole rabbit serum produced by repeated immunizations with a synthetic peptide corresponding to an internal region of Human DELTA-4. |
Rabbit Polyclonal Anti-Notch 1 (Cleaved-Val1744) Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-Notch 1 (Cleaved-Val1744) Antibody: A synthesized peptide derived from human Notch 1 (Cleaved-Val1744) |
Rabbit Polyclonal Anti-DLL3 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-DLL3 antibody is: synthetic peptide directed towards the C-terminal region of Human DLL3. Synthetic peptide located within the following region: LVCACAPGYMGARCEFPVHPDGASALPAAPPGLRPGDPQRYLLPPALGLL |
Rabbit Polyclonal Notch1 Antibody
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | DNA immunization. This antibody is specific for the N Terminus Region of the target protein. |
Rabbit polyclonal anti-NOTCH 1 antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | This whole rabbit serum was prepared by repeated immunizations with a synthetic peptide corresponding to amino acid residues of human Notch 1 located near the N-terminal sequence of the cleaved N intracellular domain (NICD). |
Rabbit Polyclonal Anti-DLL1 Antibody
| Applications | WB |
| Reactivities | Human, Rat |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-DLL1 antibody: synthetic peptide directed towards the N terminal of human DLL1. Synthetic peptide located within the following region: GSRCALALAVLSALLCQVWSSGVFELKLQEFVNKKGLLGNRNCCRGGAGP |
Rabbit Polyclonal Anti-DLL3 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-DLL3 antibody: synthetic peptide directed towards the N terminal of human DLL3. Synthetic peptide located within the following region: MVSPRMSGLLSQTVILALIFLPQTRPAGVFELQIHSFGPGPGPGAPRSPC |
Goat Anti-DLL1 Antibody
| Applications | WB |
| Reactivities | Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence C-ATQRHLTVGEEWSQD, from the internal region of the protein sequence according to NP_005609.3. |
Rabbit polyclonal anti-Notch 1 antibody
| Applications | IHC |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Anti-Notch antibody was prepared by repeated immunizations with a synthetic peptide corresponding to amino acid residues 2488-2502 of human Notch 1. A residue of cysteine was added to the amino terminal end to facilitate coupling. |
Goat Anti-DLL4 Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence KNTNQKKELEVDC, from the internal region of the protein sequence according to NP_061947.1. |
Rabbit polyclonal Anti-DLL4 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-DLL4 antibody: synthetic peptide directed towards the N terminal of human DLL4. Synthetic peptide located within the following region: PGPCTFGTVSTPVLGTNSFAVRDDSSGGGRNPLQLPFNFTWPGTFSLIIE |
Rabbit polyclonal Anti-DLL4 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-DLL4 antibody: synthetic peptide directed towards the N terminal of human DLL4. Synthetic peptide located within the following region: QGSLAVGQNWLLDEQTSTLTRLRYSYRVICSDNYYGDNCSRLCKKRNDHF |
Rabbit Polyclonal HES-1 Antibody
| Applications | IHC |
| Reactivities | Bovine, Human, Mouse, Primate, Rat |
| Conjugation | Unconjugated |
| Immunogen | A portion of amino acids 230-280 of human HES1 was used as the immunogen. |
Rabbit anti Notch 1 Polyclonal Antibody
| Applications | IHC |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | A synthetic peptide derived from C-terminus of human Notch 1. |
Carrier-free (BSA/glycerol-free) Notch1 mouse monoclonal antibody, clone OTI3E12 (formerly 3E12)
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) Notch1 mouse monoclonal antibody, clone OTI4C9 (formerly 4C9)
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) HES1 mouse monoclonal antibody, clone OTI1B9 (formerly 1B9)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) HES1 mouse monoclonal antibody, clone OTI2H4 (formerly 2H4)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) NOTCH1 mouse monoclonal antibody, clone OTI2E7 (formerly 2E7)
| Applications | IHC |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Anti-NOTCH1 rabbit polyclonal antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide corresponding to a region derived from 2541-2555 amino acids of Human notch 1 |
Anti-NOTCH1 Rabbit Polyclonal Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide corresponding to a region derived from 2541-2555 amino acids of human notch 1 |
Anti-Notch1 mouse monoclonal antibody, clone OTI3E12 (formerly 3E12)
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Anti-Notch1 mouse monoclonal antibody, clone OTI3E12 (formerly 3E12)
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Active filters
Conjugates
- Unconjugated
Families
- Cancer stem cells
Pathways
- Notch signaling pathway