Rabbit polyclonal Caspase 9 (Cleaved-Asp315) antibody
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from human Caspase 9. |
Rabbit polyclonal Caspase 9 (Cleaved-Asp315) antibody
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from human Caspase 9. |
Mouse Monoclonal anti-P53 Antibody
Applications | IHC, WB |
Reactivities | Human, non-human primates |
Conjugation | Unconjugated |
Rabbit Polyclonal p53 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-p53 antibody: human p53 (tumor protein p53), using a KLH-conjugated synthetic peptide containing a sequence from the C-terminal part of the protein. |
BCL2 Rabbit Polyclonal Antibody
Applications | ICC/IF, IP, WB |
Reactivities | Human, Rat, Mouse |
Conjugation | Unconjugated |
Immunogen | A synthetic peptide of human BCL2 |
Rabbit polyclonal Caspase 9 (Tyr153) antibody(Phospho-specific)
Applications | IF, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human Caspase 9 around the phosphorylation site of tyrosine 153 (L-A-YP-I-L). |
Modifications | Phospho-specific |
Goat Polyclonal Anti-P53 Antibody
Applications | IF, WB |
Reactivities | Canine, Human, Monkey, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Purified recombinant peptide derived from within residues 280 aa to the C-terminus of human P53 produced in E. coli. |
Goat Polyclonal Antibody against BCL2
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Peptide with sequence AGRTGYDNREIVMKYC, from the N Terminus of the protein sequence according to NP_000624; NP_000648. |
Rabbit Polyclonal Bcl-2 Antibody
Applications | IF, IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Bcl-2 antibody was raised against a peptide corresponding to 15 amino acids near the N-terminus of human Bcl-2. |
Rabbit Polyclonal Caspase 9 (Thr125) Antibody (Phospho-specific)
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against A synthesized peptide derived from human Caspase 9 around the phosphorylation site of Threonine 125 |
Modifications | Phospho-specific |
Rabbit anti-TP53 Polyclonal Antibody
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human TP53 |
Rabbit Polyclonal Anti-Caspase 9 (Cleaved-Asp353) Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-Caspase 9 (Cleaved-Asp353) Antibody: A synthesized peptide derived from human Caspase 9 (Cleaved-Asp353) |
Goat Polyclonal Anti-P53 Antibody
Applications | IF, WB |
Reactivities | Canine, Human, Monkey, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Purified recombinant peptide derived from within residues 280 aa to the C-terminus of human P53 produced in E. coli. |
Rabbit polyclonal Caspase 9 (Thr125) antibody(Phospho-specific)
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human Caspase 9 around the phosphorylation site of threonine 125 (P-E-TP-P-R). |
Modifications | Phospho-specific |
Rabbit polyclonal CASP9 Antibody (Center)
Applications | IF, IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | This CASP9 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 183-211 amino acids from the Central region of human CASP9. |
Rabbit Polyclonal p53 (Ser20) Antibody (Phospho-specific)
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against A synthesized peptide derived from human p53 around the phosphorylation site of Serine 20 |
Modifications | Phospho-specific |
Rabbit Polyclonal p53 (Ser392) Antibody (Phospho-specific)
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against A synthesized peptide derived from human p53 around the phosphorylation site of Serine 392 |
Modifications | Phospho-specific |
Rabbit polyclonal p53 (Ab-15) antibody
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized non-phosphopeptide derived from human p53 around the phosphorylation site of Serine 15. |
Rabbit polyclonal p53 (Phospho-Ser15) antibody
Applications | IHC, WB |
Reactivities | Human, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human p53 around the phosphorylation site of Serine 15 (P-L-SP-Q-E). |
Modifications | Phospho-specific |
Rabbit Polyclonal anti-p53-Acetylated (Lys382) Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Modified peptide |
Rabbit Polyclonal Anti-BCL-2 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-BCL-2 Antibody: A synthesized peptide derived from human BCL-2 |
Rabbit Polyclonal Anti-p53 Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-p53 Antibody: A synthesized peptide derived from human p53 |
Rabbit Polyclonal Anti-p53 Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-p53 Antibody: A synthesized peptide derived from human p53 |
Rabbit Polyclonal Anti-p53 Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-p53 Antibody: A synthesized peptide derived from human p53 |
Rabbit Polyclonal Antibody against TP53 (T55)
Applications | IF, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | This p53 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 33-62 amino acids from human p53. |
Rabbit Polyclonal Bcl-2 Antibody
Applications | IF, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Bcl-2 antibody was raised against a peptide corresponding to 14 amino acids near the middle of human Bcl-2. |
Rabbit polyclonal Phospho-p53(T18) Antibody
Applications | Dot, IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | This p53 Antibody is generated from rabbits immunized with a KLH conjugated synthetic phosphopeptide corresponding to amino acid residues surrounding T18 of human p53. |
Modifications | Phospho-specific |
Rabbit polyclonal p53 Antibody (S315)
Applications | IF, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | This p53 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 293-322 amino acids from human p53. |
Rabbit Polyclonal BCL-2 (Ser70) Antibody (Phospho-specific)
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against A synthesized peptide derived from human BCL-2 around the phosphorylation site of Serine 70 |
Modifications | Phospho-specific |
Rabbit Polyclonal BCL-2 (Ser87) Antibody (Phospho-specific)
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against A synthesized peptide derived from human BCL-2 around the phosphorylation site of Serine 87 |
Modifications | Phospho-specific |
Rabbit Polyclonal Caspase 9 Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against A synthesized peptide derived from human Caspase 9 |
Rabbit Polyclonal p53 (Ser315) Antibody (Phospho-specific)
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against A synthesized peptide derived from human p53 around the phosphorylation site of Serine 315 |
Modifications | Phospho-specific |
Rabbit Polyclonal p53 (Ser366) Antibody (Phospho-specific)
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against A synthesized peptide derived from human p53 around the phosphorylation site of Serine 366 |
Modifications | Phospho-specific |
Rabbit Polyclonal p53 (Ser46) Antibody (Phospho-specific)
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against A synthesized peptide derived from human p53 around the phosphorylation site of Serine 46 |
Modifications | Phospho-specific |
Rabbit Polyclonal p53 (Ser9) Antibody (Phospho-specific)
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against A synthesized peptide derived from human p53 around the phosphorylation site of Serine 9 |
Modifications | Phospho-specific |
Rabbit polyclonal BCL2 (Phospho-Ser70) antibody
Applications | WB |
Reactivities | Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human BCL2 around the phosphorylation site of serine 70 (R-T-SP-P-L). |
Modifications | Phospho-specific |
Rabbit polyclonal p53 (Ab-46) antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized non-phosphopeptide derived from human p53 around the phosphorylation site of Serine 46. |
Rabbit polyclonal p53 antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from internal of human p53. |
Rabbit polyclonal p53 (Phospho-Thr387) antibody
Applications | IHC |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human p53 around the phosphorylation site of threonine 387 (F-K-TP-E-G). |
Modifications | Phospho-specific |
Rabbit polyclonal p53 (Phospho-Ser46) antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human p53 around the phosphorylation site of Serine 46. |
Modifications | Phospho-specific |
Rabbit polyclonal p53 (Ab-378) antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized non-phosphopeptide derived from human p53 around the phosphorylation site of serine 378 (S-T-SP-R-H). |
Rabbit anti-CASP9 Polyclonal Antibody
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human CASP9 |
Rabbit Polyclonal Phospho-BCL-2 (Thr69) Antibody (Phospho-specific)
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against A synthesized peptide derived from human BCL-2 around the phosphorylation site of Threonine 69 |
Modifications | Phospho-specific |
Rabbit Polyclonal anti-TP53 antibody
Applications | Assay, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-TP53 antibody: synthetic peptide directed towards the N terminal of human TP53. Synthetic peptide located within the following region: EEPQSDPSVEPPLSQETFSDLWKLLPENNVLSPLPSQAMDDLMLSPDDIE |
Rabbit Polyclonal anti-TP53 antibody
Applications | Assay, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-TP53 antibody: synthetic peptide directed towards the N terminal of human TP53. Synthetic peptide located within the following region: EEPQSDPSVEPPLSQETFSDLWKLLPENNVLSPLPSQAMDDLMLSPDDIE |
Rabbit anti-BCL2 Polyclonal Antibody
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human BCL2 |
Rabbit Polyclonal Bcl2 Antibody
Applications | ELISA |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | DNA immunization. This antibody is specific for the N Terminus Region of the target protein. |
Rabbit Polyclonal Antibody against TP53 (S15)
Applications | IF, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | This p53 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 1-30 amino acids from human p53. |
Rabbit Polyclonal Daxx Antibody
Applications | IF, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Daxx antibody was raised against a peptide corresponding to amino acids near the carboxy terminus of human Daxx. The immunogen is located within the last 50 amino acids of Daxx. |
Rabbit Polyclonal Caspase-9 Antibody
Applications | IF, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Caspase-9 antibody was raised against a peptide corresponding to amino acids 299 to 318 of human caspase-9 . |
Rabbit polyclonal antibody to Caspase-9 (caspase 9, apoptosis-related cysteine peptidase)
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Recombinant fragment corresponding to a region within amino acids 88 and 416 of Caspase 9 (Uniprot ID#P55211) |