Primary Antibodies

View as table Download

Rabbit polyclonal Bi-Phospho-ERK1/2(T202/Y204) Antibody

Applications Dot, WB
Reactivities Human
Conjugation Unconjugated
Immunogen This ERK1/2 Antibody is generated from rabbits immunized with a KLH conjugated synthetic phosphopeptide corresponding to amino acid residues surrounding T202/Y204 of human ERK1/2.
Modifications Phospho-specific

Rabbit Monoclonal Antibody against NOTCH1 (Clone EP1238Y)

Applications IF, IHC, WB
Reactivities Human, Mouse, Cow
Conjugation Unconjugated

Rabbit anti-PRNP Polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant protein of human PRNP

Prion protein PrP (PRNP) mouse monoclonal antibody, clone EM-20, Aff - Purified

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated

Rabbit polyclonal Notch 1 (Cleaved-Val1744) antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from human Notch 1.

Rabbit polyclonal p44/42 MAPK antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from human ERK1/2.

Rabbit Polyclonal ERK1/2 Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against A synthesized peptide derived from human ERK1/2

Rabbit Polyclonal ERK1/2 (Thr202/Tyr204) Antibody (Phospho-specific)

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against A synthesized peptide derived from human ERK1/2 around the phosphorylation site of Threonine 202/Tyrosine 204
Modifications Phospho-specific

Rabbit Polyclonal Anti-Notch 1 (Cleaved-Val1744) Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The immunogen for anti-Notch 1 (Cleaved-Val1744) Antibody: A synthesized peptide derived from human Notch 1 (Cleaved-Val1744)

Rabbit Polyclonal Anti-NCAM1 Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide of human NCAM1

Rabbit Polyclonal NCAM Antibody

Applications ELISA, WB
Reactivities Human
Conjugation Unconjugated
Immunogen DNA immunization. This antibody is specific for the C Terminus Region of the target protein.

Rabbit polyclonal MAPK3 Antibody (N-term)

Applications FC, IHC, WB
Reactivities Human, Monkey, Mouse, Rat
Conjugation Unconjugated
Immunogen This MAPK3 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 1-30 amino acids from the N-terminal region of human MAPK3.

Rabbit Polyclonal ERK1/2 (Tyr204) Antibody (Phospho-specific)

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against A synthesized peptide derived from human ERK1/2 around the phosphorylation site of Tyrosine 204
Modifications Phospho-specific

Rabbit Polyclonal p44/42 MAP Kinase (Thr202) Antibody (Phospho-specific)

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against A synthesized peptide derived from human p44/42 MAP Kinase around the phosphorylation site of Threonine 202
Modifications Phospho-specific

Rabbit polyclonal p44 MAPK antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human p44 MAPK.

Mouse Monoclonal Notch-1 Antibody (mN1A)

Applications FC, IF, WB
Reactivities Human, Mouse, Rat (Negative)
Conjugation Unconjugated

Rabbit Polyclonal Notch-1 Antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen A synthetic peptide made to a C-terminal portion of the human NOTCH1 protein (between residues 2300-2350) [UniProt P46531]

Rabbit Polyclonal Notch1 Antibody

Reactivities Human
Conjugation Unconjugated
Immunogen DNA immunization. This antibody is specific for the N Terminus Region of the target protein.

Rabbit Polyclonal Prion protein Antibody

Applications ELISA
Reactivities Human
Conjugation Unconjugated
Immunogen DNA immunization. This antibody is specific for the N Terminus Region of the target protein.

ERK1 (MAPK3) rabbit polyclonal antibody, Aff - Purified

Applications IF, WB
Reactivities Human, Mouse, Rat

ERK1 (MAPK3) (+ERK2) rabbit polyclonal antibody, Aff - Purified

Applications IF, WB
Reactivities Human, Mouse, Rat

ERK1 (MAPK3) pThr202/pTyr204 rabbit polyclonal antibody, Aff - Purified

Applications IHC, WB
Reactivities Human, Mouse, Rat

Rabbit polyclonal anti-NOTCH 1 antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen This whole rabbit serum was prepared by repeated immunizations with a synthetic peptide corresponding to amino acid residues of human Notch 1 located near the N-terminal sequence of the cleaved N intracellular domain (NICD).

Anti-NCAM1 (CD56) Rabbit Polyclonal Antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Peptide sequence around aa.850~854(Q-T-K-E-N)derived from Human CD56(NCAM).

CD56 (NCAM1) mouse monoclonal antibody, clone B-A19, Azide Free

Applications FC
Reactivities Human

CD56 (NCAM1) mouse monoclonal antibody, clone B-A19, Purified

Applications FC
Reactivities Human

CD56 (NCAM1) mouse monoclonal antibody, clone B-A19, PE

Applications FC
Reactivities Human
Conjugation PE

ERK1 (MAPK3) (+ERK2) rabbit polyclonal antibody, Aff - Purified

Applications WB
Reactivities Human, Mouse, Rat

CD56 (NCAM1) (C-term) rabbit polyclonal antibody, Aff - Purified

Applications WB
Reactivities Human, Mouse, Rat
Immunogen A synthetic peptide corresponding to the C-teminal end of human CD56

NOTCH1 rabbit polyclonal antibody, Aff - Purified

Applications WB
Reactivities Human
Immunogen Synthetic peptide corresponding to a sequence at the middle region of human NOTCH1

NOTCH1 (C-term) rabbit polyclonal antibody, Purified

Applications IHC
Reactivities Human
Immunogen A synthetic peptide from C-terminal of human notch-1

Goat Polyclonal Antibody against ERK1 / MAPK3

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Peptide with sequence GGEPRRTEGVGP-C, from the N Terminus of the protein sequence according to NP_002737.1.

Goat Polyclonal Antibody against Prion Protein (143-153)

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Peptide with sequence C-SDYEDRYYREN, from the internal region of the protein sequence according to NP_000302.1; NP_898902.1.

Rabbit polyclonal anti-Notch 1 antibody

Applications IHC
Reactivities Human
Conjugation Unconjugated
Immunogen Anti-Notch antibody was prepared by repeated immunizations with a synthetic peptide corresponding to amino acid residues 2488-2502 of human Notch 1. A residue of cysteine was added to the amino terminal end to facilitate coupling.

Rabbit Polyclonal erk1/2 Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against a synthesized A synthesized peptide derived from human ERK1/2.

Rabbit Polyclonal Prion protein Antibody

Applications WB
Reactivities Bovine, Sheep
Conjugation Unconjugated
Immunogen Amino acids 142-148 of BSE protein were used as the immunogen.

Rabbit Polyclonal Prion protein Antibody

Applications WB
Reactivities Bovine, Sheep, Avian
Conjugation Unconjugated
Immunogen Amino acids 162-170 of BSE protein were used as the immunogen.

Rabbit Polyclonal Prion protein Antibody

Applications WB
Reactivities Bovine, Sheep
Conjugation Unconjugated
Immunogen Amino acids 217-229 of BSE protein were used as the immunogen.

Rabbit Polyclonal Anti-PRNP Antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-Prnp antibody is: synthetic peptide directed towards the middle region of Mouse Prnp. Synthetic peptide located within the following region: GGGTHNQWNKPSKPKTNLKHVAGAAAAGAVVGGLGGYMLGSAMSRPMIHF

Mouse monoclonal Anti-NCAM Clone ERIC-1

Reactivities Human
Conjugation Unconjugated

Rabbit anti ERK1 Polyclonal Antibody

Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Rabbit anti Notch 1 Polyclonal Antibody

Applications IHC
Reactivities Human
Conjugation Unconjugated
Immunogen A synthetic peptide derived from C-terminus of human Notch 1.

Carrier-free (BSA/glycerol-free) Notch1 mouse monoclonal antibody, clone OTI3E12 (formerly 3E12)

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) Notch1 mouse monoclonal antibody, clone OTI4C9 (formerly 4C9)

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) MAPK3 mouse monoclonal antibody, clone OTI4D7 (formerly 4D7)

Applications IF, IHC, WB
Reactivities Human, Monkey, Mouse, Rat, Dog
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) NCAM1 mouse monoclonal antibody, clone OTI1G4 (formerly 1G4)

Applications IHC, WB
Reactivities Human, Monkey, Mouse, Rat, Dog
Conjugation Unconjugated