Rabbit polyclonal TNF Receptor II antibody
Applications | IF, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from C-terminal of human TNF Receptor II. |
Rabbit polyclonal TNF Receptor II antibody
Applications | IF, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from C-terminal of human TNF Receptor II. |
Rabbit polyclonal TNF Alpha antibody
Applications | IHC, WB |
Reactivities | Human, Primate |
Conjugation | Unconjugated |
Immunogen | The whole rabbit serum was prepared by repeated immunizations with recombinant human TNFa produced in E.coli. |
Rabbit polyclonal TNF alpha antibody
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The whole rabbit serum used to produce this IgG fraction antibody was prepared by repeated immunizations with recombinant human TNFa produced in E.coli. |
Anti-Human TNF-a Rabbit Polyclonal Antibody
Applications | ELISA, IHC |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | E.coli derived Recombinant Human TNF-α |
Rabbit Polyclonal Anti-TNFRSF1A Antibody
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-TNFRSF1A antibody: synthetic peptide directed towards the N terminal of human TNFRSF1A. Synthetic peptide located within the following region: MGLSTVPDLLLPLVLLELLVGIYPSGVIGLVPHLGDREKRDSVCPQGKYI |
Rabbit Polyclonal TNF-alpha Antibody
Applications | IHC |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | A synthetic peptide made to an internal portion of the human TNF alpha protein (between residues 100-200) [UniProt P01375] |
Adiponectin (ADIPOQ) mouse monoclonal antibody, clone Adn279
Applications | ELISA |
Reactivities | Human |
Conjugation | Unconjugated |
Adiponectin (ADIPOQ) mouse monoclonal antibody, clone Adn94
Applications | ELISA |
Reactivities | Human |
Conjugation | Unconjugated |
TNF alpha (TNF) mouse monoclonal antibody, clone B1E4, Biotin
Applications | ELISA |
Reactivities | Human |
Conjugation | Biotin |
TNF alpha (TNF) mouse monoclonal antibody, clone B1E4, HRP
Applications | ELISA |
Reactivities | Human |
Conjugation | HRP |
TNFRSF1B mouse monoclonal antibody, clone KT30, Aff - Purified
Applications | ELISA |
Reactivities | Human |
TNFRSF1B mouse monoclonal antibody, clone KT30, Aff - Purified
Applications | ELISA |
Reactivities | Human |
TNFRSF1B mouse monoclonal antibody, clone KT30, Aff - Purified
Applications | ELISA |
Reactivities | Human |
TNF alpha (TNF) mouse monoclonal antibody, clone B-C7, Azide Free
Applications | FN |
Reactivities | Human |
TNF alpha (TNF) mouse monoclonal antibody, clone B-D9, FITC
Applications | FC |
Conjugation | FITC |
TNF alpha (TNF) mouse monoclonal antibody, clone B-D9, PE
Applications | FC |
Reactivities | Human |
Conjugation | PE |
Leptin (LEP) rabbit polyclonal antibody, Aff - Purified
Applications | IHC |
Reactivities | Human, Mouse, Rat |
Neuropeptide Y (NPY) rabbit polyclonal antibody, Aff - Purified
Applications | IHC |
Reactivities | Human, Mouse, Rat |
TNFRSF1B (C-term) rabbit polyclonal antibody, Aff - Purified
Applications | IHC |
Reactivities | Human, Mouse, Rat |
Immunogen | Synthetic peptide derived from C-terminal of Mouse TNF-R2 |
Neuropeptide Y (NPY) guinea pig polyclonal antibody
Applications | IHC |
Reactivities | Rat |
Conjugation | Unconjugated |
Goat Anti-TNFRSF1A Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Peptide with sequence C-SDHEIDRLELQNGR, from the internal region of the protein sequence according to NP_001056.1. |
Rabbit polyclonal anti-Leptin antibody
Applications | WB |
Reactivities | Rat |
Conjugation | Unconjugated |
Immunogen | E. coli-expressed recombinant rat Leptin |
Mouse Anti-Human TNF alpha Purified (50 ug)
Reactivities | Human |
Conjugation | Unconjugated |
Rabbit Polyclonal Anti-TNF-R1 Antibody
Reactivities | Bovine, Canine, Human, Monkey, Mouse, Rabbit, Rat |
Conjugation | Unconjugated |
Immunogen | Peptide corresponding to AA 20-43 of the mouse TNF-R1 sequence, identical to rat and human over those residues |
Biotinylated Anti-Human TNF-a Goat Polyclonal Antibody
Applications | ELISA |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | E.coli derived Recombinant Human TNF-α |
Biotinylated Anti-Human TNF-a Rabbit Polyclonal Antibody
Applications | ELISA |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | E.coli derived Recombinant Human TNF-α |
Anti-Human sTNF Receptor Type II Rabbit Polyclonal Antibody
Applications | IHC |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | E.coli derived Recombinant Human sTNF Receptor Type II |
Mouse Monoclonal Anti-TNF-alpha Antibody
Reactivities | Human |
Conjugation | Unconjugated |
Mouse Monoclonal Anti-TNF-alpha Antibody
Reactivities | Human |
Conjugation | Unconjugated |
Mouse anti TNF alpha Monoclonal Antibody
Reactivities | Human |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) ADIPOQ mouse monoclonal antibody, clone OTI1B2 (formerly 1B2)
Applications | FC, IF, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) ADIPOQ mouse monoclonal antibody, clone OTI1H1 (formerly 1H1)
Applications | FC, IF, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) ADIPOQ mouse monoclonal antibody, clone OTI7B11 (formerly 7B11)
Applications | FC, IF, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) TNF mouse monoclonal antibody, clone OTI1D9 (formerly 1D9)
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) TNF mouse monoclonal antibody, clone OTI1C1 (formerly 1C1)
Applications | FC, IF, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) TNF mouse monoclonal antibody, clone OTI1H3 (formerly 1H3)
Applications | FC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) ADIPOQ mouse monoclonal antibody, clone OTI1A8 (formerly 1A8)
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) ADIPOQ mouse monoclonal antibody, clone OTI7H8 (formerly 7H8)
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) ADIPOQ mouse monoclonal antibody, clone OTI3F12 (formerly 3F12)
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) ADIPOQ mouse monoclonal antibody, clone OTI2C9 (formerly 2C9)
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) ADIPOQ mouse monoclonal antibody, clone OTI1G4 (formerly 1G4)
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Carrier-free (glycerol/BSA-free) ADIPOQ mouse monoclonal antibody, clone OTI3D11 (formerly 3D11)
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) ADIPOQ mouse monoclonal antibody,clone OTI2G8
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) ADIPOQ mouse monoclonal antibody, clone OTI7G1 (formerly 7G1)
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Carrier-free (glycerol/BSA-free) ADIPOQ mouse monoclonal antibody, clone OTI1F11 (formerly 1F11)
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) ADIPOQ mouse monoclonal antibody, clone OTI6B8 (formerly 6B8)
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) ADIPOQ mouse monoclonal antibody, clone OTI1E7 (formerly 1E7)
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) ADIPOQ mouse monoclonal antibody, clone OTI8A9 (formerly 8A9)
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) ADIPOQ mouse monoclonal antibody, clone OTI2E2 (formerly 2E2)
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) ADIPOQ mouse monoclonal antibody, clone OTI3G10 (formerly 3G10)
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |