PON3 (N-term) rabbit polyclonal antibody
Applications | WB |
Reactivities | Human |
Immunogen | KLH conjugated synthetic peptide selected from the N-terminal region of human PON3 |
PON3 (N-term) rabbit polyclonal antibody
Applications | WB |
Reactivities | Human |
Immunogen | KLH conjugated synthetic peptide selected from the N-terminal region of human PON3 |
PLA2G5 (C-term) rabbit polyclonal antibody, Aff - Purified
Applications | WB |
Reactivities | Human |
Immunogen | Synthetic peptide - KLH conjugated - corresponding to the C-terminal region (between 102-132aa) of human PLA2G5. |
Pancreatic Lipase (PNLIP) (C-term) rabbit polyclonal antibody, Aff - Purified
Applications | WB |
Reactivities | Human |
Immunogen | KLH conjugated synthetic peptide between 311-341 amino acids from the C-terminal region of human Pancreatic lipase / PNLIP |
Goat Polyclonal Antibody against PLA2G1B
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Peptide with sequence NKAHKNLDTKKYCQS, from the C Terminus of the protein sequence according to NP_000919.1. |
Goat Anti-PON1 / paraoxonase 1 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Peptide with sequence C-EEPKVTQVYAEN, from the internal region of the protein sequence according to NP_000437.3. |
Goat Anti-Endothelial lipase Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Peptide with sequence C-RFNLRTSKDPEHEG, from the internal region of the protein sequence according to NP_006024.1. |
Sheep Anti-Dopamine β-Hydroxylase, N-Terminus, Human Antibody
Applications | WB |
Reactivities | Human, non human primate |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide corresponding to amino acid residues from the N-terminal region conjugated to KLH |
PLA2G3 Rabbit Polyclonal (Internal) Antibody
Applications | IHC |
Reactivities | Gibbon, Gorilla, Human |
Immunogen | PLA2G3 antibody was raised against synthetic 16 amino acid peptide from internal region of human PLA2G3. Percent identity with other species by BLAST analysis: Human, Gorilla, Gibbon, Monkey (100%); Marmoset, Mouse, Rat, Dog, Hamster (94%); Elephant, Panda, Rabbit (88%); Bovine, Horse, Pig (81%). |
PLA2G3 Rabbit Polyclonal (Internal) Antibody
Applications | IHC |
Reactivities | Gibbon, Bovine, Gorilla, Human, Monkey, Pig |
Conjugation | Unconjugated |
Immunogen | PLA2G3 antibody was raised against synthetic 12 amino acid peptide from internal region of human PLA2G3. Percent identity with other species by BLAST analysis: Human, Gorilla, Gibbon, Monkey, Marmoset, Bovine, Elephant, Panda, Pig (100%); Mouse, Horse, Rabbit (92%); Bat, Dog, Opossum (83%). |
Rabbit polyclonal anti-Alpha-Amylase antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide surrounding amino acid 492 of human a-Amylase. |
Rabbit polyclonal anti-Alpha-Amylase antibody
Applications | WB |
Reactivities | Chicken, Human, Mouse, Rat, Pig |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide surrounding amino acid 273 of rat a-Amylase |
Anti-LIPC Rabbit Polyclonal Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Fusion protein corresponding to C terminal 220 amino acids of human lipase, hepatic |
Rabbit Polyclonal Anti-PLA2G12B Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for Anti-PLA2G12B Antibody is: synthetic peptide directed towards the N-terminal region of Human PLA2G12B. Synthetic peptide located within the following region: LVLWLSLGGGLAQSDTSPDTEESYSDWGLRHLRGSFESVNSYFDSFLELL |
Rabbit Polyclonal Anti-PLA2G3 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-PLA2G3 antibody is: synthetic peptide directed towards the C-terminal region of Human PLA2G3. Synthetic peptide located within the following region: QRRHQLQDKGTDERQPWPSEPLRGPMSFYNQCLQLTQAARRPDRQQKSWS |
Rabbit Polyclonal Anti-ST3GAL4 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-ST3GAL4 antibody: synthetic peptide directed towards the middle region of human ST3GAL4. Synthetic peptide located within the following region: IKQKPTTGLLAITLALHLCDLVHIAGFGYPDAYNKKQTIHYYEQITLKSM |
Rabbit Polyclonal Anti-ST3GAL3 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-ST3GAL3 antibody: synthetic peptide directed towards the C terminal of human ST3GAL3. Synthetic peptide located within the following region: GFGYDMSTPNAPLHYYETVRMAAIKESWTHNIQREKEFLRKLVKARVITD |
Rabbit Polyclonal Anti-ST3GAL3 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-ST3GAL3 antibody: synthetic peptide directed towards the N terminal of human ST3GAL3. Synthetic peptide located within the following region: MTAIFPRFSKPAPMFLDDSFRKWARIREFVPPFGIKGQDNLIKAILSVTK |
Rabbit Polyclonal Anti-PLA2G2E Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-PLA2G2E antibody: synthetic peptide directed towards the middle region of human PLA2G2E. Synthetic peptide located within the following region: GIFCAGRTTCQRLTCECDKRAALCFRRNLGTYNRKYAHYPNKLCTGPTPP |
Rabbit Polyclonal Anti-CNDP1 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-CNDP1 antibody: synthetic peptide directed towards the C terminal of human CNDP1. Synthetic peptide located within the following region: GSTIPIAKMFQEIVHKSVVLIPLGAVDDGEHSQNEKINRWNYIEGTKLFA |
Rabbit Polyclonal Anti-HPSE Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-HPSE antibody: synthetic peptide directed towards the N terminal of human HPSE. Synthetic peptide located within the following region: DPRFLILLGSPKLRTLARGLSPAYLRFGGTKTDFLIFDPKKESTFEERSY |
Rabbit Polyclonal Anti-HPSE Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-HPSE antibody: synthetic peptide directed towards the N terminal of human HPSE. Synthetic peptide located within the following region: KLRLEWPYQEQLLLREHYQKKFKNSTYSRSSVDVLYTFANCSGLDLIFGL |
Rabbit Polyclonal Anti-LIPC Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-LIPC antibody is: synthetic peptide directed towards the C-terminal region of LIPC. Synthetic peptide located within the following region: LKTIRVKAGETQQRMTFCSENTDDLLLRPTQEKIFVKCEIKSKTSKRKIR |
Mouse monoclonal Anti-CDw75 Clone ZB55
Reactivities | Human |
Conjugation | Unconjugated |
USD 465.00
4 Weeks
Carrier-free (BSA/glycerol-free) AMY2A mouse monoclonal antibody, clone OTI6D4 (formerly 6D4)
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) CNDP1 mouse monoclonal antibody, clone OTI2F8 (formerly 2F8)
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) LIPG mouse monoclonal antibody, clone OTI9C5 (formerly 9C5)
Applications | IF, IHC, IP, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) LIPG mouse monoclonal antibody, clone OTI6B9 (formerly 6B9)
Applications | FC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) LIPG mouse monoclonal antibody, clone OTI3G7 (formerly 3G7)
Applications | IHC, IP, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) LIPG mouse monoclonal antibody, clone OTI2H10 (formerly 2H10)
Applications | IHC, IP, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) LIPG mouse monoclonal antibody, clone OTI1B8 (formerly 1B8)
Applications | FC, IF, IHC, IP, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) LIPG mouse monoclonal antibody, clone OTI2D5 (formerly 2D5)
Applications | FC, IF, IHC, IP, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) LIPG mouse monoclonal antibody, clone OTI5C3 (formerly 5C3)
Applications | FC, IF, IHC, IP, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) LIPG mouse monoclonal antibody, clone OTI1D9 (formerly 1D9)
Applications | FC, IF, IHC, IP, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) LIPG mouse monoclonal antibody, clone OTI3C7 (formerly 3C7)
Applications | FC, IF, IHC, IP, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) LIPG mouse monoclonal antibody, clone OTI6E11 (formerly 6E11)
Applications | FC, IF, IHC, IP, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) LIPG mouse monoclonal antibody, clone OTI9F2 (formerly 9F2)
Applications | FC, IF, IHC, IP, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) LIPG mouse monoclonal antibody, clone OTI4C3 (formerly 4C3)
Applications | FC, IF, IHC, IP |
Reactivities | Human |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) LIPG mouse monoclonal antibody, clone OTI2E7 (formerly 2E7)
Applications | FC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) LIPG mouse monoclonal antibody, clone OTI4C1 (formerly 4C1)
Applications | FC, IF, IHC, IP, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) LIPG mouse monoclonal antibody, clone OTI4C10 (formerly 4C10)
Applications | FC, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) LIPG mouse monoclonal antibody, clone OTI2A5 (formerly 2A5)
Applications | FC, IF, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) LIPG mouse monoclonal antibody, clone OTI2E12 (formerly 2E12)
Applications | FC, IF, IHC, IP, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) LIPG mouse monoclonal antibody, clone OTI7C2 (formerly 7C2)
Applications | FC, IF, IHC, IP, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) LIPG mouse monoclonal antibody, clone OTI8F8 (formerly 8F8)
Applications | FC, IF, IHC, IP, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) LIPG mouse monoclonal antibody, clone OTI4A8 (formerly 4A8)
Applications | FC, IF, IHC, IP, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) LIPG mouse monoclonal antibody, clone OTI8E4 (formerly 8E4)
Applications | FC, IF, IHC, IP, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) LIPG mouse monoclonal antibody, clone OTI7D1 (formerly 7D1)
Applications | IF, IHC, IP, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) LIPG mouse monoclonal antibody, clone OTI3C4 (formerly 3C4)
Applications | IF, IHC, IP, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) LIPG mouse monoclonal antibody, clone OTI6B11 (formerly 6B11)
Applications | FC, IF, IHC, IP, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) LIPG mouse monoclonal antibody, clone OTI1E3 (formerly 1E3)
Applications | FC, IF, WB |
Reactivities | Human |
Conjugation | Unconjugated |