Primary Antibodies

Download

IL6 rat monoclonal antibody, ELISA and Luminex validated, clone OTI13A5

Applications ELISA, LMNX
Reactivities Human
Conjugation Unconjugated
Matched ELISA Pair TA700023

IL-8 Capture mouse monoclonal antibody, ELISA and Luminex validated, clone SNAP8

Applications ELISA, LMNX
Reactivities Human
Conjugation Unconjugated
Matched ELISA Pair TA700024

EGFR L858R mouse monoclonal antibody,clone UMAB233

Applications IF, IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) EGFR L858R mouse monoclonal antibody,clone UMAB233

Applications IF, IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Rabbit polyclonal EGFR (Ab-1172) antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized non-phosphopeptide derived from human EGFR around the phosphorylation site of tyrosine 1172 (P-D-YP-Q-Q).

Rabbit anti-PGF Polyclonal Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant protein of human PGF

Rabbit Polyclonal Anti-FGF2 Antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-FGF2 antibody: synthetic peptide directed towards the middle region of human FGF2. Synthetic peptide located within the following region: RLESNNYNTYRSRKYTSWYVALKRTGQYKLGSKTGPGQKAILFLPMSAKS

BMP2 (aa 261-290) rabbit polyclonal antibody, Aff - Purified

Applications IHC, WB
Reactivities Human, Mouse, Rat
Immunogen Synthetic peptide, corresponding to amino acids 261-290 of Human BMP2.

Rabbit Polyclonal Anti-WNT2B Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Synthetic peptide directed towards the middle region of human WNT2B. Synthetic peptide located within the following region: LRTCWRALSDFRRTGDYLRRRYDGAVQVMATQDGANFTAARQGYRRATRT

Rabbit Polyclonal Anti-WNT3A Antibody - C-terminal region

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-Wnt3a antibody: synthetic peptide corresponding to a region of Mouse. Synthetic peptide located within the following region: IGDFLKDKYDSASEMVVEKHRESRGWVETLRPRYTYFKVPTERDLVYYEA

Goat Polyclonal Anti-AIFM1 (aa183-195) Antibody

Applications IF, WB
Reactivities Human (Expected from sequence similarity: Cow)
Conjugation Unconjugated
Immunogen The immunogen for Anti-AIFM1 (aa183-195) Antibody: Peptide with sequence C-DDPNVTKTLRFKQ, from the internal region of the protein sequence according to NP_004199.1; NP_665811.1; NP_001124319.1.

USD 300.00

In Stock

Goat Polyclonal Anti-VEGFA Antibody

Applications IF, WB
Reactivities Canine, Human, Monkey, Mouse, Rat
Conjugation Unconjugated
Immunogen Purified recombinant human VEGFA isoform 6 produced in E. coli.

Fas Ligand (FASLG) mouse monoclonal antibody, clone B-R17, Azide Free

Applications FC, FN
Reactivities Human

IL6 mouse monoclonal antibody, clone B-E8, Azide Free

Applications ELISA, FC, FN
Reactivities Human

Rabbit Polyclonal antibody to Laminin beta 3 (laminin, beta 3)

Applications IF, IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Recombinant fragment corresponding to a region within amino acids 644 and 960 of Laminin beta 3 (Uniprot ID#Q13751)

Rabbit anti-FGFR2 Polyclonal Antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen A synthetic peptide of human FGFR2

Rabbit Polyclonal Anti-WNT3A Antibody - N-terminal region

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-WNT3A antibody: synthetic peptide directed towards the N terminal of human WNT3A. Synthetic peptide located within the following region: MAPLGYFLLLCSLKQALGSYPIWWSLAVGPQYSSLGSQPILCASIPGLVP

WNT3A mouse monoclonal antibody, clone 3A6, Purified

Applications ELISA, IHC, WB
Reactivities Human

Goat Polyclonal Antibody against FGF21

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Peptide with sequence CQRPDGALYGSLH, from the internal region of the protein sequence according to NP_061986.1.

Anti-Human PlGF-1 Rabbit Polyclonal Antibody

Applications ELISA, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen E.coli derived Recombinant Human PlGF-1

Rabbit Polyclonal Anti-WNT2B Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Synthetic peptide directed towards the middle region of human WNT2B. Synthetic peptide located within the following region: LRTCWRALSDFRRTGDYLRRRYDGAVQVMATQDGANFTAARQGYRRATRT

Rabbit Polyclonal Anti-LAMA4 Antibody

Applications IHC
Reactivities Human
Conjugation Unconjugated
Immunogen Fusion protein of human LAMA4

BMP4 rabbit polyclonal antibody, Aff - Purified

Applications IHC, WB
Reactivities Chicken, Human, Mouse, Rabbit, Rat
Immunogen Synthetic peptide surrounding amino acid 395 of Human BMP-4

Rabbit polyclonal anti-MMP-1 antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from human MMP-1 antibody.

Rabbit polyclonal anti-LAMC1 antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human LAMC1.

Anti-VEGFA Rabbit Polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Immunogen Synthetic peptide corresponding to a region derived from 23-36 amino acids of human vascular endothelial growth factor A

Rabbit Polyclonal Anti-WNT9B Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-WNT9B antibody: synthetic peptide directed towards the C terminal of human WNT9B. Synthetic peptide located within the following region: FRETGQVLKLRYDSAVKVSSATNEALGRLELWAPARQGSLTKGLAPRSGD

Rabbit Polyclonal Anti-WNT2B Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-WNT2B antibody: synthetic peptide directed towards the N terminal of human WNT2B. Synthetic peptide located within the following region: LRPGGAEEAAQLPLRRASAPVPVPSPAAPDGSRASARLGLACLLLLLLLT

TGF beta 1 (TGFB1) mouse monoclonal antibody, clone TB21, Aff - Purified

Applications Assay, ELISA, FC, IHC, NEUT, WB
Reactivities Human

Flt3 ligand (FLT3LG) rabbit polyclonal antibody, Aff - Purified

Applications IHC, WB
Reactivities Human, Mouse, Rat
Immunogen Synthetic peptide, corresponding to amino acids 180-230 of Human Flt3-L.

TGF beta 1 (TGFB1) mouse monoclonal antibody, clone 8C4, Azide Free

Applications ELISA, FN, IHC
Reactivities Human
Conjugation Unconjugated

Goat Polyclonal Antibody against FGF23

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Peptide with sequence C-RHTRSAEDDSERD, from the internal region of the protein sequence according to NP_065689.1.

Rabbit monoclonal antibody against VEGF (C-term)(EP1176Y)

Applications FC, IF, IHC
Reactivities Human, Mouse
Conjugation Unconjugated

Rabbit Polyclonal antibody to WNT11 (wingless-type MMTV integration site family, member 11)

Applications IF, IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Recombinant fragment corresponding to a region within amino acids 1 and 310 of WNT11 (Uniprot ID#O96014)

Rabbit polyclonal WNT5B Antibody (Center)

Applications FC, IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen This WNT5B antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 153-182 amino acids from the Central region of human WNT5B.

Rabbit polyclonal IL8 Antibody (C-term)

Applications FC, IF, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen This IL8 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 72-99 amino acids from the C-terminal region of human IL8.

Rabbit Polyclonal Anti-LAMC1 Antibody - middle region

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-LAMC1 antibody: synthetic peptide directed towards the middle region of human LAMC1. Synthetic peptide located within the following region: GYHVKTEDPDLRTSSWIKQFDTSRFHPQDLSRSQKCIRKEGSSEISQRVQ

Goat Polyclonal Anti-NPHS2 / SRN1 Antibody

Applications WB
Reactivities Human, Mouse, Pig (Expected from sequence similarity: Cow)
Conjugation Unconjugated
Immunogen The immunogen for Anti-NPHS2 / SRN1 Antibody: Peptide with sequence C-SPSKPVEPLNPKK, from the C Terminus of the protein sequence according to NP_055440.1.

WNT3A mouse monoclonal antibody, clone 3A6, Purified

Applications ELISA, IHC, WB
Reactivities Human

IGF1 rabbit polyclonal antibody, Aff - Purified

Applications ELISA, FN, IHC, WB
Reactivities Human
Immunogen Highly pure (>98%) recombinant hIGF-1 (human Insulin Like Growth Factor-1)

Rabbit Polyclonal Wnt10b Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Wnt10b antibody was raised against a 15 amino acid peptide from near the center of human Wnt10b.

Rabbit polyclonal anti-LAMB1 antibody

Applications IF, IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from C-terminal of human LAMB1.

Anti-Human IGF-I Rabbit Polyclonal Antibody

Applications IHC
Reactivities Human
Conjugation Unconjugated
Immunogen E.coli derived Recombinant Human IGF-I

Biotinylated Anti-Human PlGF-1 Rabbit Polyclonal Antibody

Applications ELISA
Reactivities Human
Conjugation Unconjugated
Immunogen E.coli derived Recombinant Human PlGF-1

Rabbit Polyclonal Anti-WNT5A Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-WNT5A antibody: synthetic peptide directed towards the middle region of human WNT5A. Synthetic peptide located within the following region: GGCGDNIDYGYRFAKEFVDARERERIHAKGSYESARILMNLHNNEAGRRT

Rabbit Polyclonal BMP-2 Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen A synthetic peptide made to an internal region of human BMP2 (within residues 250-350) [Swiss-Prot# P12643]

Rabbit Polyclonal Anti-MMP1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-MMP1 Antibody: A synthesized peptide derived from human MMP1

IGF1 mouse monoclonal antibody, clone M23/ILG1-001, Purified

Applications ELISA, R
Reactivities Human