Primary Antibodies

View as table Download

BCL2 Rabbit Polyclonal Antibody

Applications ICC/IF, IP, WB
Reactivities Human, Rat, Mouse
Conjugation Unconjugated
Immunogen A synthetic peptide of human BCL2

Rabbit polyclonal Caspase 9 (Tyr153) antibody(Phospho-specific)

Applications IF, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized phosphopeptide derived from human Caspase 9 around the phosphorylation site of tyrosine 153 (L-A-YP-I-L).
Modifications Phospho-specific

USD 320.00

In Stock

Goat Polyclonal Anti-P53 Antibody

Applications IF, WB
Reactivities Canine, Human, Monkey, Mouse, Rat
Conjugation Unconjugated
Immunogen Purified recombinant peptide derived from within residues 280 aa to the C-terminus of human P53 produced in E. coli.

Goat Polyclonal Antibody against BCL2

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Peptide with sequence AGRTGYDNREIVMKYC, from the N Terminus of the protein sequence according to NP_000624; NP_000648.

Rabbit Polyclonal Bcl-2 Antibody

Applications IF, IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Bcl-2 antibody was raised against a peptide corresponding to 15 amino acids near the N-terminus of human Bcl-2.

Rabbit Polyclonal Caspase 9 (Thr125) Antibody (Phospho-specific)

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against A synthesized peptide derived from human Caspase 9 around the phosphorylation site of Threonine 125
Modifications Phospho-specific

Rabbit anti-CASP6 Polyclonal Antibody

Applications ICC/IF, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Recombinant protein of human CASP6

Rabbit anti-TP53 Polyclonal Antibody

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant protein of human TP53

Rabbit Polyclonal Anti-Caspase 9 (Cleaved-Asp353) Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The immunogen for anti-Caspase 9 (Cleaved-Asp353) Antibody: A synthesized peptide derived from human Caspase 9 (Cleaved-Asp353)

USD 320.00

In Stock

Goat Polyclonal Anti-P53 Antibody

Applications IF, WB
Reactivities Canine, Human, Monkey, Mouse, Rat
Conjugation Unconjugated
Immunogen Purified recombinant peptide derived from within residues 280 aa to the C-terminus of human P53 produced in E. coli.

Rabbit polyclonal Caspase 9 (Thr125) antibody(Phospho-specific)

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized phosphopeptide derived from human Caspase 9 around the phosphorylation site of threonine 125 (P-E-TP-P-R).
Modifications Phospho-specific

Rabbit polyclonal CASP9 Antibody (Center)

Applications IF, IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen This CASP9 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 183-211 amino acids from the Central region of human CASP9.

Rabbit Polyclonal p53 (Ser20) Antibody (Phospho-specific)

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against A synthesized peptide derived from human p53 around the phosphorylation site of Serine 20
Modifications Phospho-specific

Rabbit Polyclonal Anti-p53 Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The immunogen for anti-p53 Antibody: A synthesized peptide derived from human p53

Rabbit Polyclonal Anti-p53 Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The immunogen for anti-p53 Antibody: A synthesized peptide derived from human p53

Rabbit Polyclonal Anti-p53 Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The immunogen for anti-p53 Antibody: A synthesized peptide derived from human p53

Rabbit polyclonal Caspase 6 (Ab-257) antibody

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized non-phosphopeptide derived from human Caspase 6 around the phosphorylation site of serine 257 (K-V-SP-Q-R).

Rabbit polyclonal Phospho-p53(T18) Antibody

Applications Dot, IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen This p53 Antibody is generated from rabbits immunized with a KLH conjugated synthetic phosphopeptide corresponding to amino acid residues surrounding T18 of human p53.
Modifications Phospho-specific

Rabbit Polyclonal BCL-2 (Ser87) Antibody (Phospho-specific)

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against A synthesized peptide derived from human BCL-2 around the phosphorylation site of Serine 87
Modifications Phospho-specific

Rabbit Polyclonal Caspase 9 Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against A synthesized peptide derived from human Caspase 9

Rabbit polyclonal BCL2 (Phospho-Ser70) antibody

Applications WB
Reactivities Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized phosphopeptide derived from human BCL2 around the phosphorylation site of serine 70 (R-T-SP-P-L).
Modifications Phospho-specific

Rabbit polyclonal p53 antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human p53.

Rabbit polyclonal p53 (Ab-378) antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized non-phosphopeptide derived from human p53 around the phosphorylation site of serine 378 (S-T-SP-R-H).

Rabbit anti-CASP9 Polyclonal Antibody

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant protein of human CASP9

Rabbit anti-BCL2 Polyclonal Antibody

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant protein of human BCL2

Rabbit polyclonal Caspase 6 (Ser257) antibody(Phospho-specific)

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized phosphopeptide derived from human Caspase 6 around the phosphorylation site of serine 257 (K-V-SP-Q-R).
Modifications Phospho-specific

Rabbit polyclonal CASP6 Antibody (C-term)

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen This CASP6 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 235-263 amino acids from the C-terminal region of human CASP6.

Rabbit Polyclonal BCL-2 Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against A synthesized peptide derived from human BCL-2

Rabbit Polyclonal p53 Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against A synthesized peptide derived from human p53

Rabbit Polyclonal Caspase-6 Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat, Canine
Conjugation Unconjugated
Immunogen Recombinant catalytically active human Caspase-6 protein was used as immunogen.

Rabbit Polyclonal Caspase-9 Antibody

Applications IHC
Reactivities Human, Mouse, Rat, Canine, Gerbil
Conjugation Unconjugated
Immunogen Recombinant catalytically active human Caspase-9 protein was used as immunogen (NP_001220).

Rabbit Polyclonal Caspase-9 Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat, Canine, Gerbil
Conjugation Unconjugated
Immunogen Recombinant full-length human Caspase-9 protein (pro-form) was used as an immunogen (NP_001220).

Mouse Monoclonal p53 Antibody (PAb 240)

Applications WB
Reactivities Human, Mouse, Rat, Yeast (Does not react with: Xenopus)
Conjugation Unconjugated

Rabbit anti p53 Polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen A synthetic peptide corresponding to the N-terminus of human p53 protein

Rabbit anti P53(pS15) Polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen A synthetic peptide corresponding to the epitope –PLSQE- at a phosphorylation site at serine 15 of human p53 protein

Rabbit anti P53(pS37) Polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen A synthetic peptide corresponding to the epitope –LPSPH- at a phosphorylation site at serine 37 of human p53 protein

Rabbit Polyclonal Caspase-9 Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Caspase-9 antibody was raised against a peptide corresponding to amino acids 41 to 56 of human caspase-9 .

Goat Polyclonal Caspase 6 (alpha) Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Peptide with sequence NRKVSQRRVDFCKDP, from the internal region of the protein sequence according to NP_001217.2; NP_116787.1

Mouse Monoclonal anti-Bcl-2 Antibody

Applications WB
Reactivities Mouse, Rat
Conjugation Unconjugated

Rabbit Polyclonal Anti-TRP53 Antibody

Applications WB
Reactivities Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-TRP53 antibody: synthetic peptide corresponding to a region of Mouse. Synthetic peptide located within the following region: TEEENFRKKEVLCPELPPGSAKRALPTCTSASPPQKKKPLDGEYFTLKIR

Mouse anti p53 Monoclonal Antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Rabbit anti Caspase 6 Polyclonal Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen A synthetic peptide derived from C-terminus of human Caspase 6 protein. This sequence is identical to human rat and mouse species.

Rabbit anti BCL-2 (pThr129) Polyclonal Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen A synthetic peptide derived from epitope –FATVV- with the phosphorylation site Thr129 of human BCL-2 protein. This sequence is identical in human, rat, mouse, bovine and dog.

Rabbit anti BCL-2(pS70) Polyclonal Antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen A synthetic peptide derived from epitope –ARTSPL- with the phosphorylation site Ser70 of human BCL-2 protein

Rabbit anti BCL-2(pT56) Polyclonal Antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen A synthetic peptide derived from epitope –GHTPH- with the phosphorylation site Thr56 of human BCL-2 protein.

Carrier-free (BSA/glycerol-free) TP53 mouse monoclonal antibody, clone OTI2E4 (formerly 2E4)

Applications FC, IF, WB
Reactivities Human, Monkey, Mouse
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) TP53 mouse monoclonal antibody, clone OTI5E2 (formerly 5E2)

Applications FC, IF, IHC, WB
Reactivities Human, Monkey, Mouse
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) TP53 mouse monoclonal antibody, clone OTI1D11 (formerly 1D11)

Applications FC, IF, IHC, WB
Reactivities Human, Monkey, Mouse
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) TP53 mouse monoclonal antibody, clone OTI1D1 (formerly 1D1)

Applications FC, IF, WB
Reactivities Human, Monkey, Mouse
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) BCL2 mouse monoclonal antibody, clone OTI2E5 (formerly 2E5)

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated