Primary Antibodies

View as table Download

PKM2 Rabbit Polyclonal Antibody

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant Protein of human PKM2

PKM2 (PKM) (Isoform M1) rabbit polyclonal antibody, Aff - Purified

Applications IF, WB
Reactivities Human, Mouse
Immunogen Peptide sequence around aa. 399~403 derived from Human PKM1.

Rabbit Polyclonal Anti-PKM2 Antibody - middle region

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-PKM2 antibody: synthetic peptide directed towards the middle region of human PKM2. Synthetic peptide located within the following region: HLQLFEELRRLAPITSDPTEATAVGAVEASFKCCSGAIIVLTKSGRSAHQ

PKM2 (PKM) (Isoform M1) rabbit polyclonal antibody, Aff - Purified

Applications IF, WB
Reactivities Human, Mouse
Immunogen Peptide sequence around aa. 399~403 derived from Human PKM1.

Rabbit Polyclonal PKM2 Antibody

Applications WB
Reactivities Bovine, Human, Mouse, Rat
Conjugation Unconjugated
Immunogen A synthetic peptide made to the internal region of human PKM2 protein (within residues 350-450). [Swiss-Prot# P14618]

Rabbit Polyclonal Anti-PKM2 Antibody - N-terminal region

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-PKM2 antibody: synthetic peptide directed towards the N terminal of human PKM2. Synthetic peptide located within the following region: MSKPHSEAGTAFIQTQQLHAAMADTFLEHMCRLDIDSPPITARNTGIICT

Rabbit Polyclonal Anti-PKM2 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-PKM2 Antibody: Peptide sequence around aa.405~409(T-S-D-P-T) derived from Human PKM2.

PKM2 (PKM) (N-term) rabbit polyclonal antibody, Purified

Applications FC, IHC, WB
Reactivities Human
Immunogen KLH conjugated synthetic peptide between 123~153 amino acids from the N-terminal region of Human PKM2.

Rabbit polyclonal Pyruvate Kinase (PKM2) Antibody (C-term)

Applications IF, IHC, WB
Reactivities Human, Monkey, Mouse, Rat
Conjugation Unconjugated
Immunogen This Pyruvate Kinase (PKM2) antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 476-505 amino acids from the C-terminal region of human Pyruvate Kinase (PKM2).

PKM2 (PKM) mouse monoclonal antibody, clone AT1B10, Purified

Applications ELISA, WB
Reactivities Human

PKM2 (PKM) mouse monoclonal antibody, clone AT1B10, Purified

Applications ELISA, WB
Reactivities Human

PKM2 (PKM) (36-40) rabbit polyclonal antibody, Aff - Purified

Applications WB
Reactivities Human
Immunogen Peptide sequence around aa. 36~40

PKM2 (PKM) (36-40) rabbit polyclonal antibody, Aff - Purified

Applications WB
Reactivities Human
Immunogen Peptide sequence around aa. 36~40

Phospho-PKM2-S37 Rabbit Polyclonal Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen A phospho specific peptide corresponding to residues surrounding S37 of human PKM2

Anti-PKM2 Rabbit Polyclonal Antibody

Applications ELISA, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein corresponding to a region derived from 11-221 amino acids of Human Pyruvate kinase isozymes M1/M2

Anti-PKM2 Rabbit Polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein corresponding to a region derived from 11-221 amino acids of Human Pyruvate kinase isozymes M1/M2

Rabbit Polyclonal Anti-PKM Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide of human PKM