Primary Antibodies

View as table Download

DiMethyl-Histone H3-K4 Rabbit Polyclonal Antibody

Applications ChIP, ICC/IF, IHC, IP, WB
Reactivities Human, Mouse, Rat, Other (Wide Range)
Conjugation Unconjugated
Immunogen A synthetic methylated peptide corresponding to residues surrounding K4 of human histone H3

DiMethyl-Histone H3-K36 Rabbit Polyclonal Antibody

Applications ChIP, ICC/IF, IHC, IP, WB
Reactivities Human, Mouse, Rat, Other (Wide Range)
Conjugation Unconjugated
Immunogen A synthetic methylated peptide corresponding to residues surrounding K36 of human histone H3

Symmetric DiMethyl-Histone H3-R8 Rabbit Polyclonal Antibody

Applications ChIP, ICC/IF, IHC, IP, WB
Reactivities Human, Mouse, Rat, Other (Wide Range)
Conjugation Unconjugated
Immunogen A synthetic methylated peptide corresponding to residues surrounding R8 of human histone H3

MonoMethyl-Histone H3-K27 Rabbit Polyclonal Antibody

Applications ChIP, Dot, ICC/IF, IHC, WB
Reactivities Human, Mouse, Rat, Other (Wide Range)
Conjugation Unconjugated
Immunogen A synthetic methylated peptide corresponding to residues surrounding K27 of human histone H3

TriMethyl-Histone H3-K79 Rabbit Polyclonal Antibody

Applications ChIP, Dot, ICC/IF, IHC, WB
Reactivities Human, Mouse, Rat, Other (Wide Range)
Conjugation Unconjugated
Immunogen A synthetic methylated peptide corresponding to residues surrounding K79 of human histone H3

Rabbit anti-Histone H4K20me2 Polyclonal Antibody

Applications ChIP, ICC/IF, IHC, IP, WB
Reactivities Human, Mouse, Rat, Other (Wide Range)
Conjugation Unconjugated
Immunogen A synthetic methylated peptide corresponding to residues surrounding K20 of human histone H4

Rabbit Polyclonal Anti-ACTN1 Antibody - N-terminal region

Applications IHC, WB
Reactivities Human, Rat
Conjugation Unconjugated
Immunogen The immunogen for anti-ACTN1 antibody: synthetic peptide directed towards the N terminal of human ACTN1. Synthetic peptide located within the following region: DHYDSQQTNDYMQPEEDWDRDLLLDPAWEKQQRKTFTAWCNSHLRKAGTQ

Rabbit Anti-NMDA NR2B Subunit Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein from the C-terminal region of the NR2B subunit

Rabbit anti-Histone H3K9me3 Polyclonal Antibody

Applications ChIP, Dot, ICC/IF, IHC, WB
Reactivities Human, Mouse, Rat, Other (Wide Range)
Conjugation Unconjugated
Immunogen A synthetic methylated peptide corresponding to residues surrounding K9 of human histone H3

CD86 Rabbit Polyclonal Antibody

Applications ICC/IF, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant protein of human CD86

MonoMethyl-Histone H3-K4 Rabbit Polyclonal Antibody

Applications ChIP, ICC/IF, IHC, IP, WB
Reactivities Human, Mouse, Rat, Other (Wide Range)
Conjugation Unconjugated
Immunogen A synthetic methylated peptide corresponding to residues surrounding K4 of human histone H3

MonoMethyl-Histone H3-K9 Rabbit Polyclonal Antibody

Applications ChIP, Dot, ICC/IF, IHC, WB
Reactivities Human, Mouse, Rat, Other (Wide Range)
Conjugation Unconjugated
Immunogen A synthetic methylated peptide corresponding to residues surrounding K9 of human histone H3

DiMethyl-Histone H3-K9 Rabbit Polyclonal Antibody

Applications ChIP, ICC/IF, IHC, IP, WB
Reactivities Human, Mouse, Rat, Other (Wide Range)
Conjugation Unconjugated
Immunogen A synthetic methylated peptide corresponding to residues surrounding K9 of human histone H3

TriMethyl-Histone H3-K27 Rabbit Polyclonal Antibody

Applications ChIP, ICC/IF, IHC, IP, WB
Reactivities Human, Mouse, Rat, Other (Wide Range)
Conjugation Unconjugated
Immunogen A synthetic methylated peptide corresponding to residues surrounding K27 of human histone H3

TriMethyl-Histone H3-K36 Rabbit Polyclonal Antibody

Applications ChIP, ICC/IF, IHC, IP, WB
Reactivities Human, Mouse, Rat, Other (Wide Range)
Conjugation Unconjugated
Immunogen A synthetic tri-methylated peptide corresponding to residues surrounding K36 of human histone H3

MonoMethyl-Histone H3-K79 Rabbit Polyclonal Antibody

Applications ChIP, ICC/IF, IHC, IP, WB
Reactivities Human, Mouse, Rat, Other (Wide Range)
Conjugation Unconjugated
Immunogen A synthetic methylated peptide corresponding to residues surrounding K79 of human histone H3

DiMethyl-Histone H3-K79 Rabbit Polyclonal Antibody

Applications ChIP, ICC/IF, IHC, IP, WB
Reactivities Human, Mouse, Rat, Other (Wide Range)
Conjugation Unconjugated
Immunogen A synthetic peptideof human Histone H3K79me2

DiMethyl-Histone H3-K27 Rabbit Polyclonal Antibody

Applications ChIP, ICC/IF, IP, WB
Reactivities Human, Mouse, Rat, Other (Wide Range)
Conjugation Unconjugated
Immunogen A synthetic methylated peptide corresponding to residues surrounding K27 of human histone H3

MonoMethyl-Histone H3-K36 Rabbit Polyclonal Antibody

Applications ChIP, ICC/IF, IP, WB
Reactivities Human, Mouse, Rat, Other (Wide Range)
Conjugation Unconjugated
Immunogen A synthetic methylated peptide corresponding to residues surrounding K36 of human histone H3

MonoMethyl-Histone H3-R26 Rabbit Polyclonal Antibody

Applications ICC/IF, IP, WB
Reactivities Human, Mouse, Rat, Other (Wide Range)
Conjugation Unconjugated
Immunogen A synthetic methylated peptide corresponding to residues surrounding R26 of human histone H3

Rabbit Polyclonal Anti-TAF9 Antibody

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen TAF9 antibody was raised against a 17 amino acid peptide near the center of human TAF9.

FCGR2A Rabbit Polyclonal Antibody

Applications ICC/IF, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant protein of human FCGR2A

Symmetric DiMethyl-Histone H3-R2 Rabbit Polyclonal Antibody

Applications ChIP, ICC/IF, IHC, IP, WB
Reactivities Human, Mouse, Rat, Other (Wide Range)
Conjugation Unconjugated
Immunogen A synthetic methylated peptide corresponding to residues surrounding R2 of human histone H3

MonoMethyl-Histone H3-R17 Rabbit Polyclonal Antibody

Applications ChIP, ICC/IF, IHC, IP, WB
Reactivities Human, Mouse, Rat, Other (Wide Range)
Conjugation Unconjugated
Immunogen A synthetic mono-methylated peptide peptide corresponding to residues surrounding Arg17of human histone H3

MonoMethyl-Histone H3-R8 Rabbit Polyclonal Antibody

Applications ChIP, ICC/IF, IHC, IP, WB
Reactivities Human, Mouse, Rat, Other (Wide Range)
Conjugation Unconjugated
Immunogen A synthetic methylated peptide corresponding to residues surrounding R8 of human histone H3

TriMethyl-Histone H3-K4 Rabbit Polyclonal Antibody

Applications ChIP, Dot, IHC, WB
Reactivities Human, Mouse, Rat, Other (Wide Range)
Conjugation Unconjugated
Immunogen A synthetic methylated peptide corresponding to residues surrounding K4 of human histone H3

Asymmetric DiMethyl-Histone H3-R2 Rabbit Polyclonal Antibody

Applications ChIP, ICC/IF, IP, WB
Reactivities Human, Mouse, Rat, Other (Wide Range)
Conjugation Unconjugated
Immunogen A synthetic methylated peptide corresponding to residues surrounding R2 of human histone H3

Asymmetric DiMethyl-Histone H3-R8 Rabbit Polyclonal Antibody

Applications ChIP, ICC/IF, IHC, WB
Reactivities Human, Mouse, Rat, Other (Wide Range)
Conjugation Unconjugated
Immunogen A synthetic methylated peptide corresponding to residues surrounding R8 of human histone H3

Rabbit anti-FCGR1A Polyclonal Antibody

Applications ICC/IF, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant protein of human FCGR1A

Asymmetric DiMethyl-Histone H3-R17 Rabbit Polyclonal Antibody

Applications ICC/IF, IP, WB
Reactivities Human, Mouse, Rat, Other (Wide Range)
Conjugation Unconjugated
Immunogen A synthetic methylated peptide corresponding to residues surrounding Arg17of human histone H3

Rabbit polyclonal anti-TNFA antibody

Applications IF, IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human TNFA.

Anti-HLA-DRA Rabbit Polyclonal Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein corresponding to a region derived from 26-216 amino acids of human major histocompatibility complex, class II, DR alpha

Asymmetric DiMethyl-Histone H3-R26 Rabbit Polyclonal Antibody

Applications ICC/IF, WB
Reactivities Human, Mouse, Rat, Other (Wide Range)
Conjugation Unconjugated
Immunogen A synthetic methylated peptide corresponding to residues surrounding Arg26 of human histone H3

Symmetric DiMethyl-Histone H3-R17 Rabbit Polyclonal Antibody

Applications ICC/IF, WB
Reactivities Human, Mouse, Rat, Other (Wide Range)
Conjugation Unconjugated
Immunogen A synthetic methylated peptide corresponding to residues surrounding Arg17of human histone H3

Symmetric DiMethyl-Histone H3-R26 Rabbit Polyclonal Antibody

Applications ICC/IF, WB
Reactivities Human, Mouse, Rat, Other (Wide Range)
Conjugation Unconjugated
Immunogen A synthetic methylated peptide corresponding to residues surrounding Arg26 of human histone H3

TriMethyl-Histone H3-K14 Rabbit Polyclonal Antibody

Applications ChIP, ICC/IF, IHC, IP, WB
Reactivities Human, Mouse, Rat, Other (Wide Range)
Conjugation Unconjugated
Immunogen A synthetic methylated peptide corresponding to residues surrounding K14 of human histone H3

Rabbit anti-TRIM21 Polyclonal Antibody

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant protein of human TRIM21

Histone H3 Rabbit Polyclonal Antibody

Applications ChIP, IHC, IP, WB
Reactivities Human, Mouse, Rat, Other (Wide Range)
Conjugation Unconjugated
Immunogen Recombinant protein of human Histone H3

DiMethyl-Histone H3-K14 Rabbit Polyclonal Antibody

Applications ChIP, ICC/IF, IP, WB
Reactivities Human, Mouse, Rat, Other (Wide Range)
Conjugation Unconjugated
Immunogen A synthetic methylated peptide corresponding to residues surrounding K14 of human histone H3

HLA-DRA Rabbit Polyclonal Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant protein of human HLA-DRA

Rabbit Polyclonal antibody to Histone H2A.Z (H2A histone family, member Z)

Applications Assay, IF, IHC, IP, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Synthetic peptide contain a sequence corresponding to a region within amino acids 65 and 128 of Histone H2A.Z

Rabbit polyclonal Actinin alpha-2/3 antibody

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from N-terminal of human Actinin a-2/3.

Rabbit anti-HIST2H2BE Polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant protein of human HIST2H2BE

USD 320.00

In Stock

Goat Polyclonal Anti-IL10 Antibody

Applications WB
Reactivities Canine, Human, Monkey, Mouse, Rat
Conjugation Unconjugated
Immunogen Purified recombinant human IL10 produced in E. coli.

Rabbit Monoclonal Antibody against ACTN1 (Clone EP2527Y)

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Rabbit polyclonal NMDAR2B (Tyr1336) antibody(Phospho-specific)

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized phosphopeptide derived from human NMDAR2B around the phosphorylation site of tyrosine 1336 (S-P-YP-A-H).
Modifications Phospho-specific

Rabbit polyclonal Histone H2A antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from Internal of human Histone H2A.

Rabbit polyclonal Histone H3 (Ab-28) antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized non-phosphopeptide derived from human Histone H3 around the phosphorylation site of serine 28 (R-K-SP-A-P).

Rabbit polyclonal anti-Histone H2B antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to the N-terminus of human Histone H2B