Germany
Japan
United Kingdom
China
Carrier-free (BSA/glycerol-free) TIGIT mouse monoclonal antibody, clone OTI8G7
| Applications | IHC |
| Reactivities | Human |
| Conjugation | Unconjugated |
Primary Antibodies
View as table Download
TIGIT mouse monoclonal antibody, clone OTI8G7
| Applications | IHC |
| Reactivities | Human |
| Conjugation | Unconjugated |
USD 462.00
2 Weeks
TIGIT mouse monoclonal antibody, clone OTI8G7, Biotinylated
| Applications | IHC |
| Reactivities | Human |
| Conjugation | Biotin |
TIGIT mouse monoclonal antibody, clone OTI8G7, HRP conjugated
| Applications | IHC |
| Reactivities | Human |
| Conjugation | HRP |
Rabbit Polyclonal Anti-TIGIT Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-TIGIT antibody is: synthetic peptide directed towards the C-terminal region of Human TIGIT. Synthetic peptide located within the following region: ALRIHSVEGDLRRKSAGQEEWSPSAPSPPGSCVQAEAAPAGLCGEQRGED |
TIGIT mouse monoclonal antibody, clone OTI8G7
| Applications | IHC |
| Reactivities | Human |
| Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) TIGIT mouse monoclonal antibody,clone OTI5A2
| Applications | FC |
| Reactivities | Human |
| Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) TIGIT mouse monoclonal antibody, clone OTI9G2
| Applications | IHC |
| Reactivities | Human |
TIGIT Rabbit polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human TIGIT. |
| Modifications | Unmodified |
Recombinant Anti-TIGIT (Clone 4D4)
| Applications | FC |
| Reactivities | Mouse |
| Conjugation | Unconjugated |
Recombinant Anti-TIGIT (Clone 4D4)
| Applications | FC |
| Reactivities | Mouse |
| Conjugation | Unconjugated |
| Modifications | This chimeric rabbit antibody was made using the variable domain sequences of the original Hamster format, for improved compatibility with existing reagents, assays and techniques. |
Recombinant Anti-TIGIT (Clone 1B4)
| Applications | Bl, ELISA, FC |
| Reactivities | Mouse |
| Conjugation | Unconjugated |
Recombinant Anti-TIGIT (Clone 1B4)
| Applications | Bl, ELISA, FC |
| Reactivities | Mouse |
| Conjugation | Unconjugated |
| Modifications | This chimeric rabbit antibody was made using the variable domain sequences of the original Mouse IgG1 format, for improved compatibility with existing reagents, assays and techniques. |
USD 420.00
4 Weeks
TIGIT mouse monoclonal antibody,clone OTI5A2
| Applications | FC |
| Reactivities | Human |
| Conjugation | Unconjugated |
USD 420.00
4 Weeks
TIGIT mouse monoclonal antibody,clone OTI5A2, Biotinylated
| Applications | FC |
| Reactivities | Human |
| Conjugation | Biotin |
TIGIT mouse monoclonal antibody,clone OTI5A2, HRP conjugated
| Applications | FC |
| Reactivities | Human |
| Conjugation | HRP |
TIGIT mouse monoclonal antibody,clone OTI5A2
| Applications | FC |
| Reactivities | Human |
| Conjugation | Unconjugated |
USD 420.00
4 Weeks
TIGIT mouse monoclonal antibody, clone OTI9G2
| Applications | IHC |
| Reactivities | Human |
TIGIT mouse monoclonal antibody, clone OTI9G2
| Applications | IHC |
| Reactivities | Human |
USD 420.00
4 Weeks
USD 420.00
4 Weeks
Active filters
Target Symbol
- TIGIT
Filter by
Category
Reactivities
Antibody Hosts
Clonalities
Conjugates
Carrier-free
Modifications
- This chimeric rabbit antibody was made using the variable domain sequences of the original Hamster format, for improved compatibility with existing reagents, assays and techniques. (1)
- This chimeric rabbit antibody was made using the variable domain sequences of the original Mouse IgG1 format, for improved compatibility with existing reagents, assays and techniques. (1)
- Unmodified (1)