Germany
Japan
United Kingdom
China
Primary Antibodies
View as table Download
Rabbit Polyclonal p53 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-p53 antibody: human p53 (tumor protein p53), using a KLH-conjugated synthetic peptide containing a sequence from the C-terminal part of the protein. |
USD 300.00
2 Weeks
p53 (TP53) (Wild type + Mutant) (20-31) mouse monoclonal antibody, clone Bp53-11, Aff - Purified
| Applications | ELISA, IF, IHC, IP, WB |
| Reactivities | Human |
p53 (TP53) mouse monoclonal antibody, clone B-P3, Azide Free
| Applications | FC, IHC, IP, WB |
| Reactivities | Human |
Rabbit Polyclonal p53 (Ser20) Antibody (Phospho-specific)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against A synthesized peptide derived from human p53 around the phosphorylation site of Serine 20 |
| Modifications | Phospho-specific |
Rabbit Polyclonal p53 (Ser392) Antibody (Phospho-specific)
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against A synthesized peptide derived from human p53 around the phosphorylation site of Serine 392 |
| Modifications | Phospho-specific |
Rabbit polyclonal p53 (Phospho-Ser15) antibody
| Applications | IHC, WB |
| Reactivities | Human, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human p53 around the phosphorylation site of Serine 15 (P-L-SP-Q-E). |
| Modifications | Phospho-specific |
Rabbit Polyclonal anti-p53-Acetylated (Lys382) Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Modified peptide |
Rabbit Polyclonal Anti-p53 Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-p53 Antibody: A synthesized peptide derived from human p53 |
Rabbit Polyclonal Anti-p53 Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-p53 Antibody: A synthesized peptide derived from human p53 |
Rabbit Polyclonal Anti-p53 Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-p53 Antibody: A synthesized peptide derived from human p53 |
Rabbit polyclonal Phospho-p53(T18) Antibody
| Applications | Dot, IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | This p53 Antibody is generated from rabbits immunized with a KLH conjugated synthetic phosphopeptide corresponding to amino acid residues surrounding T18 of human p53. |
| Modifications | Phospho-specific |
Rabbit Polyclonal p53 (Ser315) Antibody (Phospho-specific)
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against A synthesized peptide derived from human p53 around the phosphorylation site of Serine 315 |
| Modifications | Phospho-specific |
Rabbit Polyclonal p53 (Ser366) Antibody (Phospho-specific)
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against A synthesized peptide derived from human p53 around the phosphorylation site of Serine 366 |
| Modifications | Phospho-specific |
Rabbit Polyclonal p53 (Ser46) Antibody (Phospho-specific)
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against A synthesized peptide derived from human p53 around the phosphorylation site of Serine 46 |
| Modifications | Phospho-specific |
Rabbit Polyclonal p53 (Ser9) Antibody (Phospho-specific)
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against A synthesized peptide derived from human p53 around the phosphorylation site of Serine 9 |
| Modifications | Phospho-specific |
Rabbit polyclonal p53 antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from internal of human p53. |
Rabbit polyclonal p53 (Phospho-Thr387) antibody
| Applications | IHC |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human p53 around the phosphorylation site of threonine 387 (F-K-TP-E-G). |
| Modifications | Phospho-specific |
Rabbit polyclonal p53 (Phospho-Ser46) antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human p53 around the phosphorylation site of Serine 46. |
| Modifications | Phospho-specific |
Rabbit Polyclonal anti-TP53 antibody
| Applications | Assay, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-TP53 antibody: synthetic peptide directed towards the N terminal of human TP53. Synthetic peptide located within the following region: EEPQSDPSVEPPLSQETFSDLWKLLPENNVLSPLPSQAMDDLMLSPDDIE |
Rabbit Polyclonal anti-TP53 antibody
| Applications | Assay, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-TP53 antibody: synthetic peptide directed towards the N terminal of human TP53. Synthetic peptide located within the following region: EEPQSDPSVEPPLSQETFSDLWKLLPENNVLSPLPSQAMDDLMLSPDDIE |
Rabbit polyclonal Phospho-p53(S20) Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This p53 Antibody is generated from rabbits immunized with a KLH conjugated synthetic phosphopeptide corresponding to amino acid residues surrounding S20 of human p53. |
| Modifications | Phospho-specific |
Rabbit Polyclonal p53 Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against A synthesized peptide derived from human p53 |
Rabbit Polyclonal p53 (Ser15) Antibody (Phospho-specific)
| Applications | WB |
| Reactivities | Human, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against A synthesized peptide derived from human p53 around the phosphorylation site of Serine 15 |
| Modifications | Phospho-specific |
Rabbit Polyclonal anti-TP53 antibody
| Applications | ELISA, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-TP53 antibody: synthetic peptide directed towards the N terminal of human TP53. Synthetic peptide located within the following region: PSQAMDDLMLSPDDIEQWFTEDPGPDEAPRMPEAAPPVAPAPAAPTPAAP |
Rabbit Polyclonal anti-TP53 antibody
| Applications | ELISA, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-TP53 antibody: synthetic peptide directed towards the N terminal of human TP53. Synthetic peptide located within the following region: EEPQSDPSVEPPLSQETFSDLWKLLPENNVLSPLPSQAMDDLMLSPDDIE |
Active filters
Target Symbol
- TP53
Filter by
Category
Reactivities
Antibody Hosts
Isotypes
Clonalities
Conjugates
Knockout (KO) Validation
Modifications
- Phospho-specific (14)
- Phospho S15 (2)
- Unmodified (2)
- Phospho S33 (1)
- Phospho S37 (1)
- Phospho S392 (1)
- Phospho S46 (1)
- Phospho S6 (1)
- Phospho S9 (1)
- Phospho T18 (1)
- Phospho T81 (1)
- This chimeric rabbit antibody was made using the variable domain sequences of the original murine IgG2a format, for improved compatibility with existing reagents, assays and techniques. (1)
Assay Types
Pathways
- Amyotrophic lateral sclerosis (ALS) (255)
- Apoptosis (255)
- Basal cell carcinoma (255)
- Bladder cancer (255)
- Cell cycle (255)
- Chronic myeloid leukemia (255)
- Colorectal cancer (255)
- Endometrial cancer (255)
- Glioma (255)
- Huntington's disease (255)
- MAPK signaling pathway (255)
- Melanoma (255)
- Neurotrophin signaling pathway (255)
- Non-small cell lung cancer (255)
- Pancreatic cancer (255)
- Pathways in cancer (255)
- Prostate cancer (255)
- Small cell lung cancer (255)
- Thyroid cancer (255)
- Wnt signaling pathway (255)
- p53 signaling pathway (255)