Germany
Japan
United Kingdom
China
Antibodies
View as table Download
Rabbit Polyclonal anti-GATA6 antibody
| Applications | IF, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-GATA6 antibody: synthetic peptide directed towards the middle region of human GATA6. Synthetic peptide located within the following region: SGAGAPVMTGAGESTNPENSELKYSGQDGLYIGVSLASPAEVTSSVRPDS |
Rabbit Polyclonal Anti-PAX3 Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-PAX3 antibody: synthetic peptide directed towards the C terminal of human PAX3. Synthetic peptide located within the following region: GGVPHQPQTDYALSPLTGGLEPTTTVSASCSQRLDHMKSLDSLPTSQSYC |
Rabbit Polyclonal Antibody against CDX2 (N-term)
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This CDX2 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 1-30 amino acids from the N-terminal region of human CDX2. |
Rabbit anti-SMAD3 (Phospho-Ser425) polyclonal antibody(Phospho-specific)
| Applications | IHC |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antibody was produced against synthesized phosphopeptide derived from humanSmad3 around the phosphorylation site of serine 425 (C-S-S-V-SP). |
| Modifications | Phospho-specific |
Rabbit polyclonal anti-SMAD3 antibody
| Applications | IHC, WB |
| Reactivities | Human, Xenopus, Xenopus Tropicalis, Zebrafish, Rat, Mouse, Swine, Bovine, Chicken |
| Conjugation | Unconjugated |
| Immunogen | This affinity purified antibody was prepared from whole rabbit serum produced by repeated immunizations with a synthetic peptide corresponding to the C-terminal domain of human SMAD3 protein. |
Rabbit polyclonal FGF4 Antibody (C-term)
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This FGF4 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 168-198 amino acids from the C-terminal region of human FGF4. |
Rabbit Polyclonal anti-UTF1 antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-UTF1 antibody: synthetic peptide directed towards the middle region of human UTF1. Synthetic peptide located within the following region: AREDPDSPPGRPEDCAPPPAAPPSLNTALLQTLGHLGDIANILGPLRDQL |
Rabbit Polyclonal Anti-BMP7 Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-BMP7 antibody: synthetic peptide directed towards the N terminal of human BMP7. Synthetic peptide located within the following region: QGKHNSAPMFMLDLYNAMAVEEGGGPGGQGFSYPYKAVFSTQGPPLASLQ |
Rabbit Polyclonal Anti-PAX7 Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-PAX7 antibody: synthetic peptide directed towards the N terminal of human PAX7. Synthetic peptide located within the following region: KEEEDEADKKEDDGEKKAKHSIDGILGDKGNRLDEGSDVESEPDLPLKRK |
Rabbit anti SOX-2 Polyclonal Antibody
| Applications | IHC, WB |
| Reactivities | Bovine, Chicken, Human, Mouse, Rat, Canis |
| Conjugation | Unconjugated |
| Immunogen | A synthetic peptide derived from N-terminus of Human SOX-2 protein. This sequence is identical among human, rat, mouse, bovine, chicken, and dog. |
Rabbit polyclonal anti-IBP1 antibody
| Applications | IHC |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from internal of human IBP1. |
Rabbit Polyclonal BMP15 Antibody
| Applications | IHC |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Rabbit polyclonal BMP15 antibody was raised against an 18 amino acid peptide near the amino terminus of human BMP15. |
Anti-Human BDNF Rabbit Polyclonal Antibody
| Applications | IHC |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | E.coli derived Recombinant Human BDNF |
Anti-Human BMP-2 Rabbit Polyclonal Antibody
| Applications | IHC |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | E.coli derived Recombinant Human BMP-2 |
Anti-Human FGF-4 Rabbit Polyclonal Antibody
| Applications | IHC |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | E.coli derived Recombinant Human FGF-4 |
Anti-Human Nanog Rabbit Polyclonal Antibody
| Applications | IHC |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | E.coli derived Recombinant Human Nanog |
Anti-PDX1 Rabbit Polyclonal Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide peptide corresponding to a region derived from 18-31 amino acids of human pancreatic and duodenal homeobox 1 |
Anti-HNF1B Rabbit Polyclonal Antibody
| Applications | IHC |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide corresponding to a region derived from 36-50 amino acids of human HNF1 homeobox B |
Anti-IGFBP1 Rabbit Polyclonal Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide peptide corresponding to a region derived from 237-249 amino acids of human insulin-like growth factor binding protein 1 |
Anti-FGF7 Rabbit Polyclonal Antibody
| Applications | IHC |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide corresponding to a region derived from 179-182 amino acids of Human Fibroblast growth factor 7 |
Anti-SOX2 Rabbit Polyclonal Antibody
| Applications | ELISA, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein corresponding to C terminal 250 amino acids of human SRY (sex determining region Y)-box 2 |
Anti-GATA6 Rabbit Polyclonal Antibody
| Applications | IHC |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide corresponding to a region derived from 9-23 amino acids of Human GATA binding protein 6 |
Anti-DPPA2 Rabbit Polyclonal Antibody
| Applications | ELISA, IHC |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein corresponding to a region derived from 92-298 amino acids of human developmental pluripotency associated 2 |
Anti-FGF4 Rabbit Polyclonal Antibody
| Applications | IHC |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide corresponding to a region derived from 192-206 amino acids of Human fibroblast growth factor 4 |
Anti-KLF5 Rabbit Polyclonal Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide corresponding to a region derived from 107-119 amino acids of Human Kruppel-like factor 5 (intestinal) |
Anti-BMP4 Rabbit Polyclonal Antibody
| Applications | ELISA, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein corresponding to a region derived from 293-408 amino acids of human bone morphogenetic protein 4 |
Active filters
Category
-
Antibodies
- Primary Antibodies
Applications
- IHC
Antibody Hosts
- Rabbit
Conjugates
- Unconjugated
Families
- Embryonic stem cells
Filter by
Target Symbol
- SMAD3 (8)
- SOX2 (8)
- BDNF (7)
- KLF4 (5)
- CD44 (4)
- CDX2 (4)
- MYC (4)
- NANOG (4)
- CD14 (3)
- EGF (3)
- FGF4 (3)
- FGF7 (3)
- FOXA2 (3)
- GATA6 (3)
- GLI3 (3)
- HNF1B (3)
- KIT (3)
- PAX3 (3)
- PDX1 (3)
- POU5F1 (3)
- PROX1 (3)
- BMP15 (2)
- BMP2 (2)
- BMP4 (2)
- BMP7 (2)
- CD9 (2)
- DPPA2 (2)
- GDF3 (2)
- GLI1 (2)
- GLI2 (2)
- IGFBP1 (2)
- KLF5 (2)
- PAX7 (2)
- SMAD2 (2)
- SOX9 (2)
- BMP6 (1)
- CCN4 (1)
- DNMT3B (1)
- FGF21 (1)
- GATA4 (1)
- GDF9 (1)
- GRB7 (1)
- HBZ (1)
- IGFBP2 (1)
- NEUROD1 (1)
- OTX2 (1)
- PDGFC (1)
- TAT (1)
- TDGF1 (1)
- UTF1 (1)
Reactivities
Clonalities
Modifications
Pathways
- Pathways in cancer (38)
- MAPK signaling pathway (24)
- TGF-beta signaling pathway (21)
- Cell cycle (14)
- Colorectal cancer (14)
- Hedgehog signaling pathway (14)
- Hematopoietic cell lineage (14)
- Regulation of actin cytoskeleton (14)
- Wnt signaling pathway (14)
- Pancreatic cancer (13)
- Chronic myeloid leukemia (12)
- Basal cell carcinoma (11)
- Cytokine-cytokine receptor interaction (11)
- Melanoma (11)
- Adherens junction (10)
- Maturity onset diabetes of the young (10)
- Acute myeloid leukemia (9)
- Endocytosis (8)
- Bladder cancer (7)
- Endometrial cancer (7)
- ErbB signaling pathway (7)
- Huntington's disease (7)
- Neurotrophin signaling pathway (7)
- Melanogenesis (5)
- ECM-receptor interaction (4)
- Focal adhesion (4)
- Gap junction (4)
- Jak-STAT signaling pathway (4)
- Prostate cancer (4)
- Small cell lung cancer (4)
- Thyroid cancer (4)
- Glioma (3)
- Non-small cell lung cancer (3)
- Pathogenic Escherichia coli infection (3)
- Toll-like receptor signaling pathway (3)
- Type II diabetes mellitus (3)
- Cysteine and methionine metabolism (2)
- Metabolic pathways (2)
- Phenylalanine (1)
- Phenylalanine metabolism (1)
- Tyrosine metabolism (1)
- Ubiquinone and other terpenoid-quinone biosynthesis (1)
- tyrosine and tryptophan biosynthesis (1)