MSH6 Rabbit Polyclonal Antibody
Applications | ICC/IF, IHC, WB |
Reactivities | Human, Mouse, Rat, Monkey |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human MSH6 |
MSH6 Rabbit Polyclonal Antibody
Applications | ICC/IF, IHC, WB |
Reactivities | Human, Mouse, Rat, Monkey |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human MSH6 |
Rabbit Polyclonal Anti-MSH6 Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-MSH6 antibody: synthetic peptide directed towards the N terminal of human MSH6. Synthetic peptide located within the following region: ISDSESDIGGSDVEFKPDTKEEGSSDEISSGVGDSESEGLNSPVKVARKR |
Rabbit anti-RPA2 Polyclonal Antibody
Applications | ChIP, IHC, IP, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human RPA2 |
LIG1 Rabbit Polyclonal Antibody
Applications | ICC/IF, IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human LIG1 |
Rabbit polyclonal anti-MtSSB antibody
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from internal of human MtSSB. |
Rabbit anti-POLD1 Polyclonal Antibody
Applications | ICC/IF, IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human POLD1 |
Rabbit Polyclonal Anti-MLH1 Antibody
Applications | IHC |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Fusion protein of human MLH1 |
Rabbit Polyclonal Anti-MSH2 Antibody
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-MSH2 antibody: synthetic peptide directed towards the N terminal of human MSH2. Synthetic peptide located within the following region: GNKASKENDWYLAYKASPGNLSQFEDILFGNNDMSASIGVVGVKMSAVDG |
Rabbit Polyclonal antibody to RPA70 (replication protein A1, 70kDa)
Applications | IF, IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Recombinant fragment corresponding to a region within amino acids 369 and 616 of RPA70 (Uniprot ID#P27694) |
Rabbit Polyclonal PCNA Antibody
Applications | ELISA, IHC, WB |
Reactivities | Human, Monkey, Mouse, Rat, Dog |
Conjugation | Unconjugated |
Immunogen | DNA immunization. This antibody is specific for the Middle Region of the target protein. |
Rabbit Polyclonal MLH1 Antibody
Applications | ELISA, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | DNA immunization. This antibody is specific for the Middle Region of the target protein. |
Rabbit Polyclonal RFC4 Antibody
Applications | ELISA, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | DNA immunization. This antibody is specific for the C Terminus Region of the target protein. |
Rabbit Polyclonal PMS2 Antibody
Applications | ELISA, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | DNA immunization. This antibody is specific for the Middle Region of the target protein. |
Rabbit polyclonal anti-PCNA antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from human PCNA. |
Rabbit polyclonal PCNA Antibody (Center)
Applications | FC, IF, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | This PCNA antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 89-117 amino acids from the Central region of human PCNA. |
Rabbit Polyclonal antibody to RFC4 (replication factor C (activator 1) 4, 37kDa)
Applications | IF, IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Recombinant fragment corresponding to a region within amino acids 18 and 323 of RFC4 (Uniprot ID#P35249) |
Rabbit polyclonal antibody to RPA 14 kDa subunit (replication protein A3, 14kDa)
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Recombinant fragment corresponding to a region within amino acids 1 and 121 of RPA14 (Uniprot ID#P35244) |
Rabbit polyclonal antibody to RPA 32 kDa subunit (replication protein A2, 32kDa)
Applications | IF, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Recombinant fragment corresponding to a region within amino acids 1 and 202 of RPA32 (Uniprot ID#P15927) |
Anti-MSH6 Rabbit Polyclonal Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Fusion protein corresponding to C terminal 300 amino acids of human mutS homolog 6 (E. coli) |
Rabbit polyclonal RFA2 (Thr21) antibody(Phospho-specific)
Applications | IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human RFA2 around the phosphorylation site of threonine 21 (G-Y-TP-Q-S). |
Modifications | Phospho-specific |
Rabbit polyclonal anti-MSH2 antibody
Applications | IF, IHC |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from internal of human MSH2. |
Rabbit polyclonal PMS2/PMS2CL antibody
Applications | IHC |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from internal of human PMS2/PMS2CL. |
Anti-PCNA Rabbit Polyclonal Antibody
Applications | ELISA, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Fusion protein corresponding to a region derived from 9-252 amino acids of Human Proliferating cell nuclear antigen |
Anti-MSH3 Rabbit Polyclonal Antibody
Applications | IHC |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Fusion protein corresponding to a C terminal 300 amino acids of human mutS homolog 3 (E. coli) |
Anti-PMS2 Rabbit Polyclonal Antibody
Applications | IHC |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide corresponding to a region derived from 638-650 amino acids of Human PMS2 postmeiotic segregation increased 2 (S. cerevisiae) |
Anti-PMS2 Rabbit Polyclonal Antibody
Applications | IHC |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide corresponding to a region derived from 638-650 amino acids of Human PMS2 postmeiotic segregation increased 2 (S. cerevisiae) |
Rabbit Polyclonal Anti-LIG1 Antibody
Applications | IHC |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Fusion protein of human LIG1 |
Rabbit Polyclonal Anti-RPA2 Antibody
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Full length fusion protein |
Rabbit Polyclonal Anti-SSBP1 Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Fusion protein of human SSBP1 |
Rabbit Polyclonal Anti-PMS2 Antibody
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide of human PMS2 |