Germany
Japan
United Kingdom
China
Antibodies
View as table Download
Rabbit Polyclonal antibody to Rad54 (alpha thalassemia/mental retardation syndrome X-linked (RAD54 homolog, S. cerevisiae))
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fragment corresponding to a region within amino acids 2161 and 2443 of Rad54 (Uniprot ID#P46100) |
Rabbit anti-STAT3 (Phospho-Tyr705) polyclonal antibody (Phospho-specific)
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from humanSTAT3 around the phosphorylation site of tyrosine 705 (A-P-YP-L-K). |
| Modifications | Phospho-specific |
Rabbit Polyclonal Anti-FGF2 Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-FGF2 antibody: synthetic peptide directed towards the middle region of human FGF2. Synthetic peptide located within the following region: RLESNNYNTYRSRKYTSWYVALKRTGQYKLGSKTGPGQKAILFLPMSAKS |
Rabbit polyclonal Nuclear Receptor NR4A1 (Ab-351) antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized non-phosphopeptide derived from human Nuclear Receptor NR4A1 around the phosphorylation site of serine 351 (L-P-SP-K-P). |
Rabbit polyclonal Syndecan4 (Ab-179) antibody
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized non-phosphopeptide derived from human Syndecan4 around the phosphorylation site of serine 179 (E-G-SP-Y-D). |
Rabbit polyclonal CP Antibody (Center)
| Applications | FC, IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | This CP antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 547-577 amino acids from the Central region of human CP. |
Rabbit Polyclonal Anti-Nectin-1 (extracellular)
| Applications | FC, IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Peptide (C)GKPPSVVSWETRLK, corresponding to amino acid residues 177- 190 of human nectin-1. Extracellular, N-terminus. |
Rabbit anti-PARP1 Polyclonal Antibody
| Applications | ICC/IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | A synthetic peptide of human PARP1 |
Rabbit anti-TFAM Polyclonal Antibody
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human TFAM |
Rabbit anti-LTBR Polyclonal Antibody
| Applications | ICC/IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human LTBR |
Rabbit Polyclonal CD4 Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat, Rabbit |
| Conjugation | Unconjugated |
| Immunogen | A synthetic peptide made to an C-terminal region of the human CD4 protein (within residues 400-458). [Swiss-Prot P01730] |
Rabbit Polyclonal Anti-GABRA5 Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-GABRA5 antibody: synthetic peptide directed towards the middle region of human GABRA5. Synthetic peptide located within the following region: GTSNTTSVSVKPSEEKTSESKKTYNSISKIDKMSRIVFPVLFGTFNLVYW |
Rabbit Polyclonal CX3CR1 Antibody
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | CX3CR1 antibody was raised against a 20 amino acid peptide near the amino terminus of human CX3CR1. The immunogen is located within the first 50 amino acids of CX3CR1. |
Rabbit Polyclonal antibody to GAD67 (glutamate decarboxylase 1 (brain, 67kDa))
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fragment corresponding to a region within amino acids 5 and 216 of GAD67 (Uniprot ID#Q99259) |
Rabbit Polyclonal antibody to RAC1 (ras-related C3 botulinum toxin substrate 1 (rho family, small GTP binding protein Rac1))
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fragment contain a sequence corresponding to a region within amino acids 1 and 196 of RAC1 (Uniprot ID#P63000 isoform B) |
Rabbit polyclonal VE-Cadherin (Tyr731) antibody(Phospho-specific)
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human VE-Cadherin around the phosphorylation site of tyrosine 731 (H-I-YP-G-Y). |
| Modifications | Phospho-specific |
Rabbit polyclonal GC Antibody (Center)
| Applications | FC, IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | This GC antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 337-365 amino acids from the Central region of human GC. |
Rabbit Polyclonal antibody to Laminin beta 3 (laminin, beta 3)
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fragment corresponding to a region within amino acids 644 and 960 of Laminin beta 3 (Uniprot ID#Q13751) |
Rabbit polyclonal GR (Ab-211) antibody
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized non-phosphopeptide derived from human GR around the phosphorylation site of serine 211 (N-E-S-P-W). |
Rabbit polyclonal MITF (Ab-180/73) antibody
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized non-phosphopeptide derived from human MITF around the phosphorylation site of serine 180/73 (P-N-SP-P-M). |
Rabbit anti-GP9 Polyclonal Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human GP9 |
Rabbit anti-SIGMAR1 Polyclonal Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human SIGMAR1 |
Rabbit Polyclonal Antibody against BCL2L2
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | This Bcl antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 24-59 amino acids from human Bcl. |
Rabbit Polyclonal antibody to Mad2L1 (MAD2 mitotic arrest deficient-like 1 (yeast))
| Applications | IF, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide corresponding to a region within amino acids 142 and 205 of MAD2L1 (Uniprot ID#Q13257) |
Rabbit Polyclonal antibody to CaMK1D (calcium/calmodulin-dependent protein kinase ID)
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fragment corresponding to a region within amino acids 1 and 385 of CaMK1D (Uniprot ID#Q8IU85) |
Rabbit polyclonal IGF1R (Tyr1346) antibody(Phospho-specific)
| Applications | IHC |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human IGF1R around the phosphorylation site of tyrosine 1346 (Q-P-YP-A-H). |
| Modifications | Phospho-specific |
Active filters
Reactivities
- Mouse
Applications
- IHC
Antibody Hosts
- Rabbit
Families
- Druggable Genome
Citations
- Yes
Filter by
Category
Target Symbol
- AOX1 (2)
- BAG3 (2)
- BAX (2)
- BDNF (2)
- COL1A1 (2)
- GAD1 (2)
- NFKB1 (2)
- RELA (2)
- SERPINA3 (2)
- ABCC4 (1)
- ABCC5 (1)
- ABCG2 (1)
- ADAM10 (1)
- ADAMDEC1 (1)
- ADAMTS5 (1)
- ADCY1 (1)
- ADH5 (1)
- AGL (1)
- AKAP12 (1)
- ALPG (1)
- ANPEP (1)
- ANTXR1 (1)
- AQP4 (1)
- ASAH1 (1)
- ATG5 (1)
- ATRX (1)
- BCL2L2 (1)
- BID (1)
- BLK (1)
- CAMK1D (1)
- CANX (1)
- CAV1 (1)
- CCND2 (1)
- CCNE1 (1)
- CD274 (1)
- CD276 (1)
- CD4 (1)
- CDH5 (1)
- CDK6 (1)
- CDKN2B (1)
- CEBPA (1)
- CENPE (1)
- CHRM1 (1)
- CP (1)
- CTNNB1 (1)
- CX3CR1 (1)
- CYP19A1 (1)
- CYP24A1 (1)
- CYP3A4 (1)
- CYP7A1 (1)
- CYP8B1 (1)
- DAPK1 (1)
- DCN (1)
- DDR1 (1)
- EGFR (1)
- FGF2 (1)
- FOXO1 (1)
- FTH1 (1)
- GAB2 (1)
- GABRA5 (1)
- GAD2 (1)
- GAS6 (1)
- GBA (1)
- GCH1 (1)
- GP9 (1)
- GPD2 (1)
- GPER1 (1)
- GPR183 (1)
- GZMB (1)
- HAVCR1 (1)
- HMMR (1)
- HMOX1 (1)
- HSP90AA1 (1)
- IFNB1 (1)
- IGF1R (1)
- IL18 (1)
- IL1B (1)
- IRF3 (1)
- IRS1 (1)
- ISG15 (1)
- ITGA6 (1)
- ITGAX (1)
- ITGB6 (1)
- JAK1 (1)
- JMJD6 (1)
- KCNAB2 (1)
- KDR (1)
- KLK5 (1)
- KLK7 (1)
- LAMA1 (1)
- LAMB3 (1)
- LIF (1)
- LIPA (1)
- LOX (1)
- LTBR (1)
- MAD2L1 (1)
- MDH2 (1)
- MITF (1)
- MSH6 (1)
- MTNR1A (1)
Clonalities
Conjugates
Knockout (KO) Validation
Modifications
Pathways
- Pathways in cancer (32)
- Metabolic pathways (21)
- Focal adhesion (19)
- MAPK signaling pathway (13)
- Small cell lung cancer (13)
- Toll-like receptor signaling pathway (13)
- Prostate cancer (12)
- Chemokine signaling pathway (11)
- ECM-receptor interaction (11)
- Neurotrophin signaling pathway (11)
- Pancreatic cancer (10)
- Regulation of actin cytoskeleton (10)
- Adipocytokine signaling pathway (9)
- Apoptosis (9)
- Cytokine-cytokine receptor interaction (9)
- Huntington's disease (9)
- NOD-like receptor signaling pathway (9)
- RIG-I-like receptor signaling pathway (9)
- Cell adhesion molecules (CAMs) (8)
- Cytosolic DNA-sensing pathway (8)
- p53 signaling pathway (8)
- Acute myeloid leukemia (7)
- Colorectal cancer (7)
- Epithelial cell signaling in Helicobacter pylori infection (7)
- Neuroactive ligand-receptor interaction (7)
- T cell receptor signaling pathway (7)
- Adherens junction (6)
- Calcium signaling pathway (6)
- Chronic myeloid leukemia (6)
- Jak-STAT signaling pathway (6)
- Leukocyte transendothelial migration (6)
- Melanoma (6)
- B cell receptor signaling pathway (5)
- Cell cycle (5)
- Glioma (5)
- Hematopoietic cell lineage (5)
- Insulin signaling pathway (5)
- Natural killer cell mediated cytotoxicity (5)
- Type I diabetes mellitus (5)
- Alzheimer's disease (4)
- Amyotrophic lateral sclerosis (ALS) (4)
- Drug metabolism - cytochrome P450 (4)
- Endocytosis (4)
- ErbB signaling pathway (4)
- Oocyte meiosis (4)
- Pathogenic Escherichia coli infection (4)
- Prion diseases (4)
- Progesterone-mediated oocyte maturation (4)
- Renal cell carcinoma (4)
- ABC transporters (3)
- Alanine (3)
- Antigen processing and presentation (3)
- Arrhythmogenic right ventricular cardiomyopathy (ARVC) (3)
- Axon guidance (3)
- Butanoate metabolism (3)
- Dilated cardiomyopathy (3)
- Endometrial cancer (3)
- Gap junction (3)
- GnRH signaling pathway (3)
- Lysosome (3)
- Melanogenesis (3)
- Porphyrin and chlorophyll metabolism (3)
- TGF-beta signaling pathway (3)
- Taurine and hypotaurine metabolism (3)
- Tight junction (3)
- Type II diabetes mellitus (3)
- Tyrosine metabolism (3)
- Valine (3)
- Viral myocarditis (3)
- Wnt signaling pathway (3)
- aspartate and glutamate metabolism (3)
- beta-Alanine metabolism (3)
- leucine and isoleucine degradation (3)
- Bladder cancer (2)
- Citrate cycle (TCA cycle) (2)
- Complement and coagulation cascades (2)
- Dorso-ventral axis formation (2)
- Fc epsilon RI signaling pathway (2)
- Fc gamma R-mediated phagocytosis (2)
- Folate biosynthesis (2)
- Graft-versus-host disease (2)
- Hypertrophic cardiomyopathy (HCM) (2)
- Metabolism of xenobiotics by cytochrome P450 (2)
- Mismatch repair (2)
- Nicotinate and nicotinamide metabolism (2)
- Non-small cell lung cancer (2)
- PPAR signaling pathway (2)
- Parkinson's disease (2)
- Primary bile acid biosynthesis (2)
- Purine metabolism (2)
- Regulation of autophagy (2)
- Retinol metabolism (2)
- SNARE interactions in vesicular transport (2)
- Sphingolipid metabolism (2)
- Tryptophan metabolism (2)
- VEGF signaling pathway (2)
- Vascular smooth muscle contraction (2)
- Vitamin B6 metabolism (2)
- Allograft rejection (1)
- Androgen and estrogen metabolism (1)
- Autoimmune thyroid disease (1)
- Basal cell carcinoma (1)
- Base excision repair (1)
- DNA replication (1)
- Drug metabolism - other enzymes (1)
- Fatty acid metabolism (1)
- Fructose and mannose metabolism (1)
- Glutathione metabolism (1)
- Glycerophospholipid metabolism (1)
- Glycolysis / Gluconeogenesis (1)
- Glyoxylate and dicarboxylate metabolism (1)
- Homologous recombination (1)
- Inositol phosphate metabolism (1)
- Linoleic acid metabolism (1)
- Long-term depression (1)
- Long-term potentiation (1)
- Methane metabolism (1)
- Notch signaling pathway (1)
- Other glycan degradation (1)
- Oxidative phosphorylation (1)
- Phosphatidylinositol signaling system (1)
- Primary immunodeficiency (1)
- Propanoate metabolism (1)
- Proteasome (1)
- Pyruvate metabolism (1)
- Renin-angiotensin system (1)
- Starch and sucrose metabolism (1)
- Steroid biosynthesis (1)
- Thyroid cancer (1)
- mTOR signaling pathway (1)