Germany
Japan
United Kingdom
China
Antibodies
View as table Download
Rabbit Polyclonal anti-TCF7L1 antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-TCF7L1 antibody: synthetic peptide directed towards the N terminal of human TCF7L1. Synthetic peptide located within the following region: NDELIPFQDEGGEEQEPSSDSASAQRDLDEVKSSLVNESENQSSSSDSEA |
Rabbit Polyclonal Anti-PPARG Antibody
| Applications | IHC, WB |
| Reactivities | Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-PPARG Antibody: synthetic peptide directed towards the N terminal of human PPARG. Synthetic peptide located within the following region: SHSFDIKPFTTVDFSSISTPHYEDIPFTRTDPVVADYKYDLKLQEYQSAI |
Rabbit Polyclonal Anti-PAX8 Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-PAX8 antibody: synthetic peptide directed towards the middle region of human PAX8. Synthetic peptide located within the following region: SSSGPRKHLRTDAFSQHHLEPLECPFERQHYPEAYASPSHTKGEQGERWW |
Rabbit Polyclonal Anti-TCF7 Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-TCF7 antibody: synthetic peptide directed towards the middle region of human TCF7. Synthetic peptide located within the following region: PAAIPHPAIVPPSGKQELQPFDRNLKTQAESKAEKEAKKPTIKKPLNAFM |
Rabbit polyclonal Trk A (Phospho-Tyr757) antibody
| Applications | IHC |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human Trk A around the phosphorylation site of tyrosine 757 (E-V-YP-A-I). |
| Modifications | Phospho-specific |
Rabbit anti ERK2 Polyclonal Antibody
| Applications | IHC |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | A synthetic peptide derived from C-terminus of ERK2 protein from human, rat, mouse and dog origins. |
Anti-MAP2K1 Rabbit Polyclonal Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide corresponding to a region derived from 15-28 amino acids of human mitogen-activated protein kinase kinase 1 |
Anti-PAX8 Rabbit Polyclonal Antibody
| Applications | ELISA, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein corresponding to C terminal 250 amino acids of human paired box 8 |
Anti-pan CDH Rabbit Polyclonal Antibody
| Applications | IHC |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide corresponding to C terminal 22 amino acids of human pan-cadherin |
Anti-PPARG Rabbit Polyclonal Antibody
| Applications | IHC |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide corresponding to a region derived from 1-15 amino acids of Human peroxisome proliferator-activated receptor gamma |
Anti-MAP2K2 Rabbit Polyclonal Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide corresponding to a region derived from 20-34 amino acids of Human mitogen-activated protein kinase kinase 2 |
Anti-CCND1 Rabbit Polyclonal Antibody
| Applications | IHC |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide corresponding to a region derived from 255-270 amino acids of Human Cyclin D1 |
Anti-NTRK1 Rabbit Polyclonal Antibody
| Applications | IHC |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide corresponding to a region derived from 781-796 amino acids of human neurotrophic tyrosine kinase, receptor, type 1 |
Rabbit Monoclonal e-cadherin Antibody
| Applications | IHC |
| Reactivities | Human |
| Conjugation | Unconjugated |
Active filters
Applications
- IHC
Antibody Hosts
- Rabbit
Conjugates
- Unconjugated
Pathways
- Thyroid cancer
Filter by
Category
Target Symbol
Reactivities
Clonalities
Modifications
Families
- Druggable Genome (79)
- Transcription Factors (37)
- Protein Kinase (28)
- Stem cell - Pluripotency (21)
- ES Cell Differentiation/IPS (15)
- Transmembrane (13)
- Stem cell relevant signaling - JAK/STAT signaling pathway (7)
- Stem cell relevant signaling - Wnt Signaling pathway (7)
- Nuclear Hormone Receptor (6)
- Embryonic stem cells (4)
- Induced pluripotent stem cells (4)
- Stem cell relevant signaling - TGFb/BMP signaling pathway (4)
- Stem cell relevant signaling - DSL/Notch pathway (3)
- Adult stem cells (2)