Germany
Japan
United Kingdom
China
Antibodies
View as table Download
Rabbit Polyclonal Anti-NPY1R Antibody
| Applications | IHC |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-NPY1R antibody: synthetic peptide directed towards the middle region of human NPY1R. Synthetic peptide located within the following region: TDEPFQNVTLDAYKDKYVCFDQFPSDSHRLSYTTLLLVLQYFGPLCFIFI |
Rabbit Polyclonal Anti-ADORA2B Antibody
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | ADORA2B antibody was raised against a 19 amino acid peptide near the carboxy terminus of human ADORA2B. The immunogen is located within the last 50 amino acids of ADORA2B. |
Rabbit Polyclonal S1P1 Antibody
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | S1P1 antibody was raised against a 14 amino acid synthetic peptide near the carboxy terminus of the human S1P1. The immunogen is located within the last 50 amino acids of S1P1. |
Rabbit Polyclonal CX3CR1 Antibody
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | CX3CR1 antibody was raised against a 20 amino acid peptide near the amino terminus of human CX3CR1. The immunogen is located within the first 50 amino acids of CX3CR1. |
Rabbit Polyclonal CXCR4 Antibody
| Applications | FC, IF, IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | CXCR4 antibody was raised against a peptide corresponding to 14 amino acids near the amino terminus of human CXCR4. The immunogen is located within the first 50 amino acids of CXCR4. |
Dopamine Receptor D3 / DRD3 Rabbit Polyclonal (Cytoplasmic Domain) Antibody
| Applications | IHC |
| Reactivities | Chimpanzee, Gorilla, Human, Monkey |
| Conjugation | Unconjugated |
| Immunogen | DRD3 / Dopamine Receptor D3 antibody was raised against synthetic 16 amino acid peptide from 3rd cytoplasmic domain of human DRD3 / Dopamine Receptor D3. Percent identity with other species by BLAST analysis: Human, Chimpanzee, Gorilla, Monkey, Marmoset (100%); Gibbon, Mouse, Dog, Bovine, Bat, Hamster, Elephant, Panda, Horse, Rabbit (94%); Rat, Pig, Opossum (88%). |
Rabbit anti-SIGMAR1 Polyclonal Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human SIGMAR1 |
GPR183 / EBI2 Rabbit Polyclonal (C-Terminus) Antibody
| Applications | IHC |
| Reactivities | Gorilla, Human |
| Conjugation | Unconjugated |
| Immunogen | GPR183 / EBI2 antibody was raised against synthetic 15 amino acid peptide from C-terminus of human GPR183 / EBI2. Percent identity with other species by BLAST analysis: Human, Gorilla, Monkey (100%); Marmoset, Mouse, Rat, Hamster, Elephant, Panda, Dog, Bat, Bovine, Horse, Rabbit, Pig (93%); Opossum, Platypus, Catfish, Zebrafish (80%). |
Rabbit anti-CHRM1 Polyclonal Antibody
| Applications | ICC/IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human CHRM1 |
Rabbit polyclonal IL-8R beta/CDw128 beta (Ser347) antibody(Phospho-specific)
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human IL-8R beta/CDw128 beta around the phosphorylation site of serine 347 (R-P-SP-F-V). |
| Modifications | Phospho-specific |
USD 425.00
In Stock
CHRM3 / M3 Rabbit Polyclonal (C-Terminus) Antibody
| Applications | IHC |
| Reactivities | Gibbon, Gorilla, Human, Monkey, Orang-Utan |
| Conjugation | Unconjugated |
| Immunogen | CHRM3 / M3 antibody was raised against synthetic 19 amino acid peptide from C-terminus of human CHRM3 / M3. Percent identity with other species by BLAST analysis: Human, Gorilla, Orangutan, Gibbon, Monkey (100%); Chimpanzee, Mouse, Rat, Sheep, Hamster, Elephant, Dog, Bovine, Horse, Rabbit, Pig, Guinea pig (95%); Opossum, Turkey, Chicken, Lizard (89%). |
Rabbit anti-PTH1R Polyclonal Antibody
| Applications | IHC, WB |
| Reactivities | Human, Rat, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human PTH1R |
USD 531.00
In Stock
CALCRL / CRLR Rabbit Polyclonal (Cytoplasmic Domain) Antibody
| Applications | IHC |
| Reactivities | Gibbon, Bovine, Dog, Xenopus, Gorilla, Goat, Hamster, Horse, Human, Monkey, Orang-Utan, Pig, Rabbit, Rat |
| Conjugation | Unconjugated |
| Immunogen | CALCRL / CGRP Receptor antibody was raised against synthetic 16 amino acid peptide from 3rd cytoplasmic domain of human CALCRL. Percent identity with other species by BLAST analysis: Human, Gorilla, Orangutan, Gibbon, Monkey, Marmoset, Rat, Goat, Hamster, Panda, Dog, Bovine, Horse, Rabbit, Pig, Opossum, Xenopus (100%); Mouse, Elephant, Bat, Guinea pig, Stickleback, Pufferfish, Zebrafish (94%); Turkey, Chicken (81%). |
CALCRL / CRLR Rabbit Polyclonal (N-Terminus) Antibody
| Applications | IHC |
| Reactivities | Gibbon, Gorilla, Human, Orang-Utan |
| Conjugation | Unconjugated |
| Immunogen | CALCRL / CGRP Receptor antibody was raised against synthetic 15 amino acid peptide from N-terminal extracellular domain of human CALCRL. Percent identity with other species by BLAST analysis: Human, Gorilla, Orangutan, Gibbon, Monkey (100%); Marmoset, Mouse, Rabbit (93%); Rat, Panda, Dog, Horse, Pig (87%); Goat, Bovine (80%). |
GPR80 / OXGR1 Rabbit Polyclonal (Extracellular Domain) Antibody
| Applications | IHC |
| Reactivities | Gibbon, Gorilla, Human |
| Conjugation | Unconjugated |
| Immunogen | GPR80 / GPR99 / OXGR1 antibody was raised against synthetic 17 amino acid peptide from 2nd extracellular domain of human OXGR1. Percent identity with other species by BLAST analysis: Human, Gorilla, Gibbon, Marmoset (100%); Monkey, Mouse, Rat, Rabbit (94%); Dog, Bat, Hamster, Panda, Horse (88%). |
Rabbit Polyclonal CXCR4 Antibody
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | CXCR4 antibody was raised against a 15 amino acid peptide near the center of human CXCR4. The immunogen is located within amino acids 170 - 220 of CXCR4. |
Rabbit Polyclonal antibody to Transmembrane protein 147 (transmembrane protein 147)
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide corresponding to a region within amino acids 37 and 131 of Transmembrane protein 147 (Uniprot ID#Q9BVK8) |
GPR4 Rabbit Polyclonal (Extracellular Domain) Antibody
| Applications | IHC |
| Reactivities | Bat, Bovine, Human, Monkey, Mouse, Rabbit, Rat, Dog, Pig, Gibbon |
| Conjugation | Unconjugated |
| Immunogen | GPR4 antibody was raised against synthetic 20 amino acid peptide from 2nd extracellular domain of human GPR4. Percent identity with other species by BLAST analysis: Human, Gibbon, Monkey, Mouse, Rat, Dog, Bat, Bovine, Panda, Rabbit, Pig (100%); Zebrafish (85%); Pufferfish, Stickleback (80%). |
GPR4 Rabbit Polyclonal (C-Terminus) Antibody
| Applications | IHC |
| Reactivities | Gibbon, Dog, Gorilla, Human, Monkey |
| Conjugation | Unconjugated |
| Immunogen | GPR4 antibody was raised against synthetic 19 amino acid peptide from C-terminus of human GPR4. Percent identity with other species by BLAST analysis: Human, Gorilla, Gibbon, Monkey, Dog, Panda (100%); Mouse, Rat, Bovine, Bat, Pig (95%); Rabbit (89%). |
Active filters
Reactivities
- Mouse
Applications
- IHC
Antibody Hosts
- Rabbit
Isotypes
- IgG
Families
- GPCR
Filter by
Category
Target Symbol
- ADRA1B (4)
- NPY1R (4)
- AGTR2 (3)
- APLNR (3)
- CCR3 (3)
- CXCR3 (3)
- CXCR4 (3)
- GRM1 (3)
- GRM3 (3)
- GRM4 (3)
- GRPR (3)
- LPAR4 (3)
- MC4R (3)
- ADRA1A (2)
- ADRB3 (2)
- BDKRB2 (2)
- CALCR (2)
- CALCRL (2)
- CCR8 (2)
- CHRM1 (2)
- CXCR2 (2)
- DRD3 (2)
- DRD4 (2)
- F2R (2)
- FPR2 (2)
- FSHR (2)
- FZD1 (2)
- FZD3 (2)
- GABBR1 (2)
- GPR3 (2)
- GPR4 (2)
- GRM2 (2)
- GRM7 (2)
- GRM8 (2)
- HCRTR1 (2)
- HTR2C (2)
- LPAR3 (2)
- MTNR1A (2)
- OXTR (2)
- P2RY1 (2)
- P2RY2 (2)
- PTGDR2 (2)
- RXFP3 (2)
- S1PR3 (2)
- S1PR5 (2)
- SIGMAR1 (2)
- SSTR1 (2)
- SSTR3 (2)
- SSTR4 (2)
- TACR2 (2)
- TSHR (2)
- ACKR1 (1)
- ACKR3 (1)
- ADCYAP1R1 (1)
- ADGRB3 (1)
- ADGRF5 (1)
- ADGRG2 (1)
- ADGRL2 (1)
- ADGRL3 (1)
- ADORA2B (1)
- ADORA3 (1)
- ADRA2A (1)
- ADRB1 (1)
- ADRB2 (1)
- AGTR1 (1)
- AVPR1B (1)
- AVPR2 (1)
- BRS3 (1)
- C3AR1 (1)
- CASR (1)
- CCR2 (1)
- CCR5 (1)
- CCR9 (1)
- CHRM2 (1)
- CHRM3 (1)
- CHRM5 (1)
- CNR2 (1)
- CX3CR1 (1)
- CXCR5 (1)
- CXCR6 (1)
- DRD1 (1)
- DRD5 (1)
- EDNRA (1)
- EDNRB (1)
- FZD10 (1)
- FZD2 (1)
- FZD4 (1)
- FZD5 (1)
- FZD6 (1)
- GCGR (1)
- GIPR (1)
- GLP1R (1)
- GLP2R (1)
- GNRHR (1)
- GPER1 (1)
- GPR15 (1)
- GPR182 (1)
- GPR183 (1)
- GPR37 (1)
- GPR39 (1)
Clonalities
Conjugates
Modifications
Pathways
- Neuroactive ligand-receptor interaction (139)
- Calcium signaling pathway (45)
- Chemokine signaling pathway (18)
- Cytokine-cytokine receptor interaction (18)
- Endocytosis (12)
- Vascular smooth muscle contraction (12)
- Melanogenesis (11)
- Basal cell carcinoma (9)
- Colorectal cancer (9)
- Gap junction (9)
- Pathways in cancer (9)
- Regulation of actin cytoskeleton (9)
- Wnt signaling pathway (9)
- Complement and coagulation cascades (5)
- Renin-angiotensin system (5)
- Long-term depression (4)
- Long-term potentiation (4)
- Axon guidance (3)
- Leukocyte transendothelial migration (3)
- Taste transduction (3)
- Autoimmune thyroid disease (2)
- Epithelial cell signaling in Helicobacter pylori infection (2)
- Dilated cardiomyopathy (1)
- GnRH signaling pathway (1)
- Huntington's disease (1)
- Parkinson's disease (1)