Rabbit anti-GLUL Polyclonal Antibody
Applications | ICC/IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human GLUL |
Rabbit anti-GLUL Polyclonal Antibody
Applications | ICC/IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human GLUL |
Rabbit Monoclonal antibody against CPS1
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Rabbit Polyclonal GLS2 Antibody
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | GLS2 antibody was raised against a 18 amino acid synthetic peptide near the center terminus of human GLS2. |
Rabbit polyclonal GLS Antibody (C-term)
Applications | FC, IF, IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | This GLS antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 516-545 amino acids from the C-terminal region of human GLS. |
Rabbit Polyclonal Antibody against Carbonic Anhydrase IX
Applications | IHC, WB |
Reactivities | Human, Dog |
Conjugation | Unconjugated |
Immunogen | A synthetic peptide derived from a C-terminal sequence of the human CA IX. |
Rabbit polyclonal anti-CA1 antibody
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from internal of human CA1. |
GLUD1 Rabbit anti-Bovine Polyclonal Antibody
Applications | IHC |
Reactivities | Bovine, Human |
Conjugation | Unconjugated |
Immunogen | GLUD1/Glutamate Dehydrogenase antibody was raised against bovine liver glutamate dehydrogenase. |
Rabbit Polyclonal GLS2 Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Antibody was raised against a 18 amino acid peptide near the center terminus of human GLS2 (NP_037399). |
Rabbit Polyclonal Anti-GLUD1 Antibody
Applications | IHC, WB |
Reactivities | Human, Rat |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-GLUD1 antibody: synthetic peptide directed towards the N terminal of human GLUD1. Synthetic peptide located within the following region: AKAGVKINPKNYTDNELEKITRRFTMELAKKGFIGPGIDVPAPDMSTGER |
Rabbit Polyclonal Anti-GLS2 Antibody
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for Anti-GLS2 Antibody: synthetic peptide directed towards the middle region of human GLS2. Synthetic peptide located within the following region: FVGKEPSGLRYNKLSLNEEGIPHNPMVNAGAIVVSSLIKMDCNKAEKFDF |
Rabbit Polyclonal Anti-HAL Antibody
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-HAL antibody: synthetic peptide directed towards the C terminal of human HAL. Synthetic peptide located within the following region: EAAHRLLLEQKVWEVAAPYIEKYRMEHIPESRPLSPTAFSLQFLHKKSTK |
Rabbit Polyclonal Anti-CTH Antibody
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-CTH antibody: synthetic peptide directed towards the C terminal of human CTH. Synthetic peptide located within the following region: ESNPWVEKVIYPGLPSHPQHELVKRQCTGCTGMVTFYIKGTLQHAEIFLK |
Glutamine Synthetase (GLUL) rabbit polyclonal antibody
Applications | IHC, WB |
Reactivities | Bovine, Human, Mouse, Rat |
Conjugation | Unconjugated |
Rabbit polyclonal CA3 Antibody (Center)
Applications | IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | This CA3 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 146-177 amino acids from the Central region of human CA3. |
Rabbit Polyclonal Anti-GLUD1 Antibody
Applications | IHC, WB |
Reactivities | Human, Rat |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-GLUD1 antibody: synthetic peptide directed towards the N terminal of human GLUD1. Synthetic peptide located within the following region: EGFFDRGASIVEDKLVEDLRTRESEEQKRNRVRGILRIIKPCNHVLSLSF |
Rabbit Polyclonal Anti-HAL Antibody
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-HAL antibody: synthetic peptide directed towards the N terminal of human HAL. Synthetic peptide located within the following region: INKLQELQVNLVRSHSSGVGKPLSPERCRMLLALRINVLAKGYSGISLET |
Rabbit Polyclonal Anti-CPS1 Antibody
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-CPS1 antibody: synthetic peptide directed towards the N terminal of human CPS1. Synthetic peptide located within the following region: QWLQEEKVPAIYGVDTRMLTKIIRDKGTMLGKIEFEGQPVDFVDPNKQNL |
Rabbit Polyclonal Anti-CPS1 Antibody
Applications | IHC, WB |
Reactivities | Human, Pig |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-CPS1 antibody: synthetic peptide directed towards the middle region of human CPS1. Synthetic peptide located within the following region: YPSVTNYLYVTYNGQEHDVNFDDHGMMVLGCGPYHIGSSVEFDWCAVSSI |
Anti-CA3 Rabbit Polyclonal Antibody
Applications | ELISA, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Fusion protein corresponding to N terminal 260 amino acids of Human Carbonic anhydrase 3 |
Anti-CA3 Rabbit Polyclonal Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Fusion protein corresponding to N terminal 260 amino acids of Human Carbonic anhydrase 3 |
Anti-CA4 Rabbit Polyclonal Antibody
Applications | ELISA, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Fusion protein corresponding to a region derived from 19-284 amino acids of Human Carbonic anhydrase 4 |
Anti-CA4 Rabbit Polyclonal Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Fusion protein corresponding to a region derived from 19-284 amino acids of Human Carbonic anhydrase 4 |
Anti-CA2 Rabbit Polyclonal Antibody
Applications | ELISA, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Full length fusion protein |
Rabbit Polyclonal Anti-ASNS Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Fusion protein of human ASNS |
Rabbit Polyclonal Anti-GLUL Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Fusion protein of human GLUL |
Rabbit Polyclonal Anti-GLS Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide of human GLS |