Germany
Japan
United Kingdom
China
USD 428.00
In Stock
Antibodies
Download
USD 180.00
In Stock
Rabbit monoclonal anti-Sox2 Antibody, clone OTIR102D11
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Rabbit monoclonal anti-Sox2 Antibody, clone OTIR094F2
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Rabbit Polyclonal tdTomato Antibody
| Applications | WB |
| Immunogen | tdTomato |
Rabbit Polyclonal mCherry Antibody
| Applications | WB |
| Immunogen | mCherry |
Rabbit Polyclonal turboGFP Antibody
| Applications | WB |
| Immunogen | Purified tGFP protein expressed in E. coli. |
Rabbit monoclonal anti-PD-L1 Antibody, clone OR-5E4
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
Rabbit monoclonal anti-PD-L1 Antibody, clone OR-5E4
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
Rabbit monoclonal anti-Sox2 Antibody, clone OTIR102D11
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Rabbit monoclonal anti-Dendra2 Antibody, clone OTIR5C7
| Applications | WB |
Rabbit monoclonal anti-Dendra2 Antibody, clone OTIR5C7
| Applications | WB |
Rabbit monoclonal anti-His tag Antibody, clone OTIR5B12
| Applications | WB |
Rabbit monoclonal anti-His tag Antibody, clone OTIR5B12
| Applications | WB |
Rabbit Anti-Mouse IgG Secondary Antibody
| Applications | WB, IHC, IF/ICC, ELISA |
| Reactivities | Mouse IgG |
| Conjugation | Unconjugated |
| Immunogen | Mouse IgG, whole molecule |
Rabbit Polyclonal mKate Antibody
| Applications | WB |
| Immunogen | Purified mKate protein expressed in E. coli. |
Anti-DDK (FLAG) rabbit polyclonal antibody
| Applications | WB |
| Immunogen | Synthetic peptide (DYKDDDDK) conjugated to KLH |
Rabbit Polyclonal mGFP Antibody
| Applications | WB |
| Immunogen | mGFP |
Rabbit Polyclonal antibody to MX1 (myxovirus (influenza virus) resistance 1, interferon-inducible protein p78 (mouse))
| Applications | IF, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fragment corresponding to a region within amino acids 194 and 475 of MX1 (Uniprot ID#P20591) |
Anti-Dendra2 rabbit polyclonal antibody
| Applications | WB |
| Immunogen | Purified Dendra2 protein expressed in E. coli. |
LYVE1 rabbit polyclonal antibody, Aff - Purified
| Applications | ELISA, FC, IF, IHC, WB |
| Reactivities | Human |
| Immunogen | Highly pure recombinant Human soluble LYVE-1 produced in insect cells (Cat.-No DA3525). It consists of amino acid 24 (Ser) to 232 (Gly) and is fused to a C-terminal His-tag (6xHis). |
Anti-MYC tag rabbit polyclonal antibody
| Applications | WB |
| Immunogen | Synthetic peptide (EQKLISEEDL) conjugated to KLH |
Anti-His tag rabbit polyclonal antibody
| Applications | WB |
| Immunogen | Synthetic peptide (HHHHHH) conjugated to KLH |
Rabbit Polyclonal eGFP Antibody
| Applications | WB |
| Immunogen | Purified eGFP protein expressed in E. coli. |
Rabbit Polyclonal Anti-EGFLAM Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-EGFLAM antibody is: synthetic peptide directed towards the C-terminal region of Human EGFLAM. Synthetic peptide located within the following region: TTAKDGLLLWRGDSPMRPNSDFISLGLRDGALVFSYNLGSGVASIMVNGS |
USD 428.00
In Stock
Rabbit Monoclonal Anti-Human IgG4 Antibody, Clone RM120
| Applications | ELISA: 50ng/well - 200ng/well for Capture;, 0.05ug/mL - 0.2ug/mL for Detection;, , WB: 0.5 ug/mL - 2 ug/mL;, ICC: 1 ug/mL-10ug/mL;, IHC: 1 ug/mL-10ug/mL |
| Reactivities | Human IgG4 |
| Conjugation | Unconjugated |
Rabbit monoclonal anti-HA tag Antibody, clone OTIR5B11
| Applications | WB |
| Conjugation | Unconjugated |
Rabbit monoclonal anti-HA tag Antibody, clone OTIR7C9
| Applications | WB |
| Conjugation | Unconjugated |
Rabbit monoclonal anti-ST13 Antibody, clone OTIR191G8
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Rabbit polyclonal Bi-Phospho-ERK1/2(T202/Y204) Antibody
| Applications | Dot, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This ERK1/2 Antibody is generated from rabbits immunized with a KLH conjugated synthetic phosphopeptide corresponding to amino acid residues surrounding T202/Y204 of human ERK1/2. |
| Modifications | Phospho-specific |
Rabbit Polyclonal mPlum Antibody
| Applications | WB |
| Immunogen | Purified mPlum protein expressed in E. coli. |
Active filters
Category
Applications
- WB
Antibody Hosts
- Rabbit
Availabilities
- In Stock
Filter by
Target Symbol
- MAPT (18)
- EGFR (17)
- AKT1 (16)
- JUN (14)
- EZR (13)
- TP53 (13)
- NR3C1 (12)
- CHEK1 (11)
- RELA (11)
- ATF2 (10)
- EIF4EBP1 (10)
- GRIN2B (10)
- MET (10)
- PRKCD (10)
- RPS6KB1 (10)
- SRC (10)
- BRAF (9)
- FGFR1 (9)
- MAPK14 (9)
- PAK1 (9)
- PDGFRB (9)
- CHUK (8)
- CREB1 (8)
- CSF1R (8)
- ERBB2 (8)
- FOXO1 (8)
- IKBKG (8)
- IRS1 (8)
- MAP2K1 (8)
- NFKB1 (8)
- NOS3 (8)
- PRKCA (8)
- PTK2 (8)
- PTPN11 (8)
- RAF1 (8)
- RUNX1 (8)
- SOX2 (8)
- STAT5A (8)
- YWHAZ (8)
- CASP3 (7)
- CCNB1 (7)
- CDC25A (7)
- CDK2 (7)
- CFLAR (7)
- CTNNB1 (7)
- ESR1 (7)
- MAP2K4 (7)
- MAPK3 (7)
- MDM2 (7)
- NFKB2 (7)
- PPP1R1B (7)
- PXN (7)
- RPS6KA5 (7)
- SNCA (7)
- STAT1 (7)
- STAT3 (7)
- ABL1 (6)
- AFP (6)
- BAD (6)
- BCL2L1 (6)
- CASP7 (6)
- DPYSL2 (6)
- ELK1 (6)
- EPHA2 (6)
- GAB2 (6)
- GSK3A (6)
- HDAC1 (6)
- IGF1R (6)
- JAK2 (6)
- MTOR (6)
- NFKBIA (6)
- RB1 (6)
- SARS-COV-2 SPIKE PROTEIN (6)
- SHC1 (6)
- SMAD1 (6)
- SMAD3 (6)
- ACTB (5)
- AGT (5)
- AKR1B1 (5)
- APP (5)
- ARF6 (5)
- BLNK (5)
- BRCA1 (5)
- CASP9 (5)
- CCNE1 (5)
- CDC25B (5)
- CDK1 (5)
- CDKN1A (5)
- CEBPA (5)
- CHEK2 (5)
- CYP2D6 (5)
- DNM1 (5)
- DUSP1 (5)
- F10 (5)
- HDAC2 (5)
- HSD17B13 (5)
- HSF1 (5)
- IRF3 (5)
- LMNA (5)
- LOX (5)
Reactivities
- Human (6225)
- Mouse (4654)
- Rat (3553)
- Bovine (77)
- Monkey (47)
- Chicken (42)
- Dog (38)
- Pig (27)
- Xenopus (20)
- Rhesus Monkey (18)
- Chimpanzee (15)
- Zebrafish (15)
- X. tropicalis (13)
- SARS-CoV-2 (11)
- Rabbit (10)
- Cow (8)
- Primate (8)
- Sheep (8)
- Hamster (5)
- Porcine (5)
- Drosophila (3)
- Feline (3)
- Guinea Pig (2)
- N-term and C-term DDK (2)
- C. elegans (1)
- Drosophila melanogaster (1)
- Equine (1)
- Ferret (1)
- Fish (1)
- Fungus (1)
- Horse (1)
- Mink (1)
- Murine (1)
- Streptococcus Pyogenes (1)
Isotypes
Clonalities
Conjugates
Knockout (KO) Validation
Modifications
Families
- Druggable Genome (4034)
- Transmembrane (1480)
- Transcription Factors (987)
- Protein Kinase (682)
- Secreted Protein (487)
- ES Cell Differentiation/IPS (438)
- Stem cell - Pluripotency (298)
- Protease (239)
- GPCR (183)
- Adult stem cells (92)
- Phosphatase (85)
- Stem cell relevant signaling - JAK/STAT signaling pathway (76)
- Embryonic stem cells (73)
- Cancer stem cells (64)
- Nuclear Hormone Receptor (60)
- Induced pluripotent stem cells (49)
- P450 (44)
- Ion Channels: Other (38)
- Stem cell relevant signaling - DSL/Notch pathway (37)
- Ion Channels: Potassium (34)
- Stem cell relevant signaling - TGFb/BMP signaling pathway (29)
- Ion Channels: Glutamate Receptors (19)
- Ion Channels: Cys-loop Receptors (14)
- Stem cell relevant signaling - Wnt Signaling pathway (12)
- Ion Channels: Transient receptor potential (9)
- Ion Channels: Sodium (4)
- Ion Channels: ATP Receptors (1)
- Ion Channels: Cyclic nucleotide gated (1)
Pathways
- Pathways in cancer (651)
- MAPK signaling pathway (466)
- Metabolic pathways (456)
- Focal adhesion (375)
- Neurotrophin signaling pathway (331)
- Prostate cancer (298)
- ErbB signaling pathway (293)
- Regulation of actin cytoskeleton (289)
- Chemokine signaling pathway (281)
- Chronic myeloid leukemia (261)
- Insulin signaling pathway (252)
- T cell receptor signaling pathway (234)
- Cell cycle (230)
- Colorectal cancer (230)
- Pancreatic cancer (230)
- Cytokine-cytokine receptor interaction (206)
- Acute myeloid leukemia (204)
- Glioma (200)
- Small cell lung cancer (200)
- Toll-like receptor signaling pathway (199)
- Apoptosis (196)
- Alzheimer's disease (194)
- Leukocyte transendothelial migration (194)
- Fc gamma R-mediated phagocytosis (192)
- Melanoma (189)
- B cell receptor signaling pathway (187)
- GnRH signaling pathway (185)
- Wnt signaling pathway (184)
- Endocytosis (179)
- Neuroactive ligand-receptor interaction (178)
- Epithelial cell signaling in Helicobacter pylori infection (174)
- VEGF signaling pathway (174)
- Jak-STAT signaling pathway (173)
- Natural killer cell mediated cytotoxicity (173)
- Non-small cell lung cancer (173)
- Progesterone-mediated oocyte maturation (173)
- Calcium signaling pathway (170)
- Adherens junction (167)
- Fc epsilon RI signaling pathway (166)
- Adipocytokine signaling pathway (161)
- Endometrial cancer (161)
- Renal cell carcinoma (159)
- Huntington's disease (156)
- Axon guidance (154)
- Tight junction (154)
- Oocyte meiosis (150)
- Bladder cancer (138)
- p53 signaling pathway (138)
- Vascular smooth muscle contraction (131)
- Gap junction (130)
- Melanogenesis (129)
- Amyotrophic lateral sclerosis (ALS) (123)
- NOD-like receptor signaling pathway (121)
- Long-term potentiation (119)
- mTOR signaling pathway (115)
- RIG-I-like receptor signaling pathway (112)
- Pathogenic Escherichia coli infection (104)
- Olfactory transduction (100)
- Parkinson's disease (96)
- Long-term depression (94)
- Ubiquitin mediated proteolysis (89)
- TGF-beta signaling pathway (88)
- Type II diabetes mellitus (83)
- Cell adhesion molecules (CAMs) (79)
- Hematopoietic cell lineage (74)
- Cytosolic DNA-sensing pathway (72)
- Thyroid cancer (72)
- Hypertrophic cardiomyopathy (HCM) (69)
- Viral myocarditis (68)
- Arrhythmogenic right ventricular cardiomyopathy (ARVC) (67)
- Dilated cardiomyopathy (66)
- Prion diseases (58)
- Systemic lupus erythematosus (58)
- Purine metabolism (56)
- Glycolysis / Gluconeogenesis (54)
- Vibrio cholerae infection (54)
- Oxidative phosphorylation (50)
- Basal cell carcinoma (49)
- Dorso-ventral axis formation (49)
- Phosphatidylinositol signaling system (49)
- Complement and coagulation cascades (48)
- PPAR signaling pathway (48)
- ECM-receptor interaction (45)
- Arginine and proline metabolism (42)
- Notch signaling pathway (42)
- Antigen processing and presentation (41)
- Lysosome (39)
- Primary immunodeficiency (38)
- Drug metabolism - cytochrome P450 (36)
- Pyruvate metabolism (36)
- Cardiac muscle contraction (34)
- Ribosome (34)
- Glycerolipid metabolism (33)
- Metabolism of xenobiotics by cytochrome P450 (32)
- Spliceosome (32)
- ABC transporters (30)
- Pyrimidine metabolism (30)
- Hedgehog signaling pathway (29)
- Fructose and mannose metabolism (28)
- Inositol phosphate metabolism (28)
- Nucleotide excision repair (28)
- Tryptophan metabolism (27)
- Valine (27)
- Arachidonic acid metabolism (26)
- Base excision repair (26)
- DNA replication (26)
- Tyrosine metabolism (26)
- Retinol metabolism (25)
- leucine and isoleucine degradation (25)
- Butanoate metabolism (24)
- SNARE interactions in vesicular transport (23)
- Fatty acid metabolism (22)
- Histidine metabolism (22)
- Alanine (21)
- Homologous recombination (21)
- Mismatch repair (21)
- Nitrogen metabolism (21)
- aspartate and glutamate metabolism (21)
- Androgen and estrogen metabolism (20)
- Lysine degradation (20)
- Regulation of autophagy (20)
- Type I diabetes mellitus (20)
- Citrate cycle (TCA cycle) (19)
- Glutathione metabolism (19)
- Proteasome (19)
- Renin-angiotensin system (19)
- Pentose phosphate pathway (18)
- Propanoate metabolism (18)
- Taste transduction (18)
- Drug metabolism - other enzymes (17)
- Starch and sucrose metabolism (17)
- Galactose metabolism (16)
- Glycerophospholipid metabolism (16)
- beta-Alanine metabolism (16)
- Amino sugar and nucleotide sugar metabolism (15)
- Basal transcription factors (15)
- Primary bile acid biosynthesis (15)
- Cysteine and methionine metabolism (14)
- Graft-versus-host disease (14)
- RNA degradation (14)
- Autoimmune thyroid disease (13)
- Biosynthesis of unsaturated fatty acids (13)
- Limonene and pinene degradation (13)
- Linoleic acid metabolism (13)
- Maturity onset diabetes of the young (13)
- Allograft rejection (12)
- Non-homologous end-joining (12)
- Ascorbate and aldarate metabolism (11)
- Glycine (11)
- Phenylalanine metabolism (11)
- Sphingolipid metabolism (11)
- serine and threonine metabolism (11)
- Asthma (10)
- Aminoacyl-tRNA biosynthesis (9)
- C21-Steroid hormone metabolism (9)
- Ether lipid metabolism (9)
- Pentose and glucuronate interconversions (9)
- Taurine and hypotaurine metabolism (9)
- Folate biosynthesis (8)
- N-Glycan biosynthesis (8)
- Selenoamino acid metabolism (8)
- Nicotinate and nicotinamide metabolism (7)
- Other glycan degradation (7)
- Riboflavin metabolism (7)
- Terpenoid backbone biosynthesis (7)
- Fatty acid biosynthesis (6)
- Glyoxylate and dicarboxylate metabolism (6)
- Porphyrin and chlorophyll metabolism (6)
- RNA polymerase (6)
- Caffeine metabolism (5)
- Glycosaminoglycan degradation (5)
- One carbon pool by folate (5)
- alpha-Linolenic acid metabolism (5)
- Circadian rhythm - mammal (4)
- Glycosphingolipid biosynthesis - ganglio series (4)
- Lysine biosynthesis (4)
- Steroid biosynthesis (4)
- leucine and isoleucine biosynthesis (4)
- Chondroitin sulfate biosynthesis (3)
- Cyanoamino acid metabolism (3)
- Fatty acid elongation in mitochondria (3)
- Heparan sulfate biosynthesis (3)
- Methane metabolism (3)
- Pantothenate and CoA biosynthesis (3)
- Phenylalanine (3)
- Synthesis and degradation of ketone bodies (3)
- Vitamin B6 metabolism (3)
- tyrosine and tryptophan biosynthesis (3)
- Keratan sulfate biosynthesis (2)
- Protein export (2)
- Sulfur metabolism (2)
- D-Glutamine and D-glutamate metabolism (1)
- Glycosphingolipid biosynthesis - globo series (1)
- Glycosphingolipid biosynthesis - lacto and neolacto series (1)
- Glycosylphosphatidylinositol(GPI)-anchor biosynthesis (1)
- O-Glycan biosynthesis (1)
- O-Mannosyl glycan biosynthesis (1)
- Thiamine metabolism (1)
- Ubiquinone and other terpenoid-quinone biosynthesis (1)