Germany
Japan
United Kingdom
China
Rabbit Polyclonal Anti-ACE2 Antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-ACE2 Antibody: A synthesized peptide |
Antibodies
View as table Download
Rabbit Polyclonal Anti-REN Antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-REN antibody: synthetic peptide directed towards the C terminal of human REN. Synthetic peptide located within the following region: YSSKKLCTLAIHAMDIPPPTGPTWALGATFIRKFYTEFDRRNNRIGFALA |
Rabbit Polyclonal Anti-ACE1 Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-ACE1 Antibody: A synthesized peptide derived from human ACE1 |
Anti-AGT Rabbit Polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide corresponding to a region derived from 34-41 amino acids of human angiotensinogen (serpin peptidase inhibitor, clade A, member 8) |
REN Rabbit Polyclonal Antibody
| Applications | WB |
| Reactivities | Human Mouse |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human REN |
Anti-AGT Rabbit Polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide peptide corresponding to a region derived from 34-41 amino acids of human angiotensinogen (serpin peptidase inhibitor, clade A, member 8) |
Anti-AGT Rabbit Polyclonal Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide corresponding to a region derived from 34-43 amino acids of human angiotensinogen (serpin peptidase inhibitor, clade A, member 8) |
Anti-AGT Rabbit Polyclonal Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide corresponding to a region derived from 34-43 amino acids of human angiotensinogen (serpin peptidase inhibitor, clade A, member 8) |
Anti-ACE1 Rabbit Polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide corresponding to a region derived from 78-92 amino acids of Human Angiotensin-converting enzyme |
Anti-ACE1 Rabbit Polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide corresponding to a region derived from 78-92 amino acids of Human Angiotensin-converting enzyme |
Rabbit Polyclonal Anti-ACE Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide of human ACE |
Active filters
Category
-
Antibodies
- Primary Antibodies
Reactivities
- Mouse
Applications
- WB
Antibody Hosts
- Rabbit
Isotypes
- IgG
Conjugates
- Unconjugated
Families
- Secreted Protein
Pathways
- Renin-angiotensin system