Germany
Japan
United Kingdom
China
Antibodies
View as table Download
Rabbit Anti-DOPA Decarboxylase, Human Antibody
| Applications | WB |
| Reactivities | Bovine, Dog, Guinea Porcine, Human, Rabbit, Rat, Sheep |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide corresponding to amino acid residues from the N-terminal region conjugated to KLH |
Rabbit anti-CYP1A1 Polyclonal Antibody
| Applications | ICC/IF, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human CYP1A1 |
Rabbit anti-WARS Polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human WARS |
Rabbit Polyclonal Anti-Cytochrome P450 1A1/2 Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-Cytochrome P450 1A1/2 Antibody: A synthesized peptide derived from human Cytochrome P450 1A1/2 |
Rabbit polyclonal Cytochrome P450 1A1/2 antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from internal of human Cytochrome P450 1A1/2. |
Rabbit polyclonal TPH2(Ser19) antibody(Phospho-specific)
| Applications | WB |
| Reactivities | Human: Ser19, Mouse: Ser19, Rat: Ser19 |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human TPH2 around the phosphorylation site of serine 19. |
| Modifications | Phospho-specific |
Rabbit polyclonal TPH2 Antibody (Center)
| Applications | FC, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This TPH2 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 168-193 amino acids from the Central region of human TPH2. |
Rabbit anti-ACAT2 polyclonal antibody
| Applications | WB |
| Reactivities | Human, Murine, Rat, Porcine, Ovine |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide derived from Human ACAT 2 |
Rabbit anti-ACAT1 polyclonal antibody
| Applications | WB |
| Reactivities | Human, Porcine, Rat, Murine |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide derived from Human ACAT1. |
Rabbit polyclonal Tryptophan Hydroxylase (Ser58) antibody(Phospho-specific)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human Tryptophan Hydroxylase around the phosphorylation site of serine 58 (R-N-SP-E-F). |
| Modifications | Phospho-specific |
Rabbit polyclonal anti-TFP1/HADHA antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide surrounding amino acid 750 of human TFP1 |
Rabbit Polyclonal Anti-Gcdh Antibody
| Applications | WB |
| Reactivities | Rat |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-Gcdh Antibody: synthetic peptide corresponding to a region of Rat. Synthetic peptide located within the following region: LQLGRLKDQDKATPEMVSLLKRNNCGKALDIARQARDILGGNGISDEYHV |
Anti-CYP1B1 Rabbit Polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein corresponding to C terminal 250 amino acids of human cytochrome P450, family 1, subfamily B, polypeptide 1 |
Anti-AOX1 rabbit polyclonal antibody
| Applications | ELISA, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein corresponding to C terminal 300 amino acids of human aldehyde oxidase 1 |
Anti-ALDH9A1 Rabbit Polyclonal Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide corresponding to a region derived from 18-32 amino acids of human aldehyde dehydrogenase 9 family, member A1 |
Rabbit Polyclonal Anti-CYP1A1 Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide of human CYP1A1 |
Active filters
Category
-
Antibodies
- Primary Antibodies
Reactivities
- Rat
Applications
- WB
Antibody Hosts
- Rabbit
Isotypes
- IgG
Families
- Druggable Genome
Pathways
- Tryptophan metabolism