Germany
Japan
United Kingdom
China
GRIA3 Rabbit Polyclonal Antibody
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human GRIA3 |
Antibodies
View as table Download
Rabbit Polyclonal GluR1 Antibody
| Applications | IF, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against A synthesized peptide derived from human GluR1 |
Phospho-IGF1R-Y1161 Rabbit Polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | A phospho specific peptide corresponding to residues surrounding Y1161 of human IGF1R |
| Modifications | Phospho-specific |
Rabbit anti-GRIA1 Polyclonal Antibody
| Applications | ICC/IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human GRIA1 |
Rabbit Polyclonal Anti-GRM5 Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-GRM5 Antibody: A synthesized peptide derived from internal of human GRM5. |
USD 531.00
In Stock
Rabbit polyclonal IGF1R (Ab-1346) antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized non-phosphopeptide derived from human IGF1R around the phosphorylation site of tyrosine 1346 (Q-P-YP-A-H). |
| Modifications | Phospho-specific |
Anti-PLA2G2A Rabbit Polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein corresponding to a region derived from 21-144 amino acids of human phospholipase A2, group IIA (platelets, synovial fluid) |
Rabbit Polyclonal GluR1 (Ser863) Antibody (Phospho-specific)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against A synthesized peptide derived from human GluR1 around the phosphorylation site of Serine 863 |
| Modifications | Phospho-specific |
Rabbit polyclonal Glutamate receptor 2 (Ab-880) antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized non-phosphopeptide derived from human Glutamate receptor 2 around the phosphorylation site of serine 880 (I-E-S-V-K). |
Rabbit polyclonal Glutamate receptor 2 (Ser880) antibody(Phospho-specific)
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human Glutamate receptor 2 around the phosphorylation site of serine 880 (I-E-SP-V-K). |
| Modifications | Phospho-specific |
Rabbit Polyclonal IGF1R Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against A synthesized peptide derived from human IGF1R |
Rabbit Polyclonal IGF1R Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against A synthesized peptide derived from human IGF1R |
Rabbit Polyclonal IGF1R (Tyr1161) Antibody (Phospho-specific)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against A synthesized peptide derived from human IGF1R around the phosphorylation site of Tyrosine 1161 |
| Modifications | Phospho-specific |
Rabbit Polyclonal IGF1R (Tyr1165/Tyr1166) Antibody (Phospho-specific)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against A synthesized peptide derived from human IGF1R around the phosphorylation site of Tyrosine 1165/Tyrosine 1166 |
| Modifications | Phospho-specific |
Rabbit anti-IGF1R polyclonal antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized non-phosphopeptide derived from humanIGF-1R around the phosphorylation site of tyrosine 1161 (D-I-YP-E-T). |
Anti-IGF1R (Phospho-Tyr1165/Tyr1166) Rabbit Polyclonal Antibody
| Applications | IF, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Peptide sequence around phosphorylation site of tyrosine 1165/tyrosine 1166 (T-D-Y(p)-Y(p)-R-K) derived from Human IGF-1R . |
| Modifications | Phospho-specific |
Rabbit Polyclonal IGF1R Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against A synthesized peptide derived from human IGF1R |
USD 415.00
3 Days
Ionotropic Glutamate receptor 2 (GRIA2) (+ GLUR3) rabbit polyclonal antibody, Aff - Purified
| Applications | WB |
| Reactivities | Chicken, Human, Mouse, Rat, Zebrafish |
| Immunogen | Peptide corresponding to amino acid residues from the C-terminal region of rat GluR2/3. |
Rabbit anti-IGF1R (Phospho-Tyr1165/Tyr1166) polyclonal antibody (Phospho-specific)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from humanIGF-1R around the phosphorylation site of tyrosine 1165/tyrosine 1166(T-D-YP-YP-R-K). |
| Modifications | Phospho-specific |
Anti-GRIA1 (phospho-Ser849) Rabbit Polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Peptide sequence around phosphorylation site of serine 849 (Q-Q-S(p)-I-N ) derived from Human GluR1. |
| Modifications | Phospho-specific |
Anti-IGF1R Rabbit Polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Peptide sequence around aa.1163~1167/1164~1168 (T-D-Y-Y-R-K) derived from Human IGF-1R . |
Anti-GRIA2 (phospho-Ser880) Rabbit Polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Peptide sequence around phosphorylation site of serine 880 (I-E-S(p)-V-K) derived from Human Glutamate receptor 2. |
| Modifications | Phospho-specific |
Phospho-GRIA2-S880 Rabbit Polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | A phospho specific peptide corresponding to residues surrounding S880 of human GRIA2 |
| Modifications | Phospho-specific |
Phospho-GRIA1-S836 Rabbit Polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | A phospho specific peptide corresponding to residues surrounding S836 of human GRIA1 |
| Modifications | Phospho-specific |
Phospho-IGF1R-Y1280 Rabbit Polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | A phospho specific peptide corresponding to residues surrounding Y1280 of human IGF1R |
| Modifications | Phospho-specific |
Rabbit Polyclonal Anti-Gria3 Antibody
| Applications | WB |
| Reactivities | Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-Gria3 antibody is: synthetic peptide directed towards the middle region of Rat Gria3. Synthetic peptide located within the following region: TVERMVSPIESAEDLAKQTEIAYGTLDSGSTKEFFRRSKIAVYEKMWSYM |
Rabbit Polyclonal Anti-Gria3 Antibody
| Applications | WB |
| Reactivities | Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-Gria3 antibody: synthetic peptide corresponding to a region of Mouse. Synthetic peptide located within the following region: EEMDRRQEKRYLIDCEVERINTILEQVVILGKHSRGYHYMLANLGFTDIV |
Rabbit Polyclonal Anti-PLA2G2E Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-PLA2G2E antibody: synthetic peptide directed towards the middle region of human PLA2G2E. Synthetic peptide located within the following region: GIFCAGRTTCQRLTCECDKRAALCFRRNLGTYNRKYAHYPNKLCTGPTPP |
Anti-GRM1 Rabbit Polyclonal Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide corresponding to a region derived from 31-44 amino acids of Human glutamate receptor, metabotropic 1 |
Rabbit Polyclonal Anti-RYR1 Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide of human RYR1 |
Rabbit Polyclonal anti-GRM5 Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human GRM5 |
Rabbit Polyclonal anti-GRM5 Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human GRM5 |
Active filters
Category
-
Antibodies
- Primary Antibodies
Applications
- WB
Antibody Hosts
- Rabbit
Isotypes
- IgG
Families
- Transmembrane
Pathways
- Long-term depression