ABCC4 Rabbit Polyclonal Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human ABCC4 |
ABCC4 Rabbit Polyclonal Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human ABCC4 |
Rabbit Polyclonal Anti-CFTR Antibody
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | CFTR antibody was raised against an 18 amino acid peptide near the carboxy terminus of human CFTR. |
Rabbit polyclonal antibody to ABCD2 (ATP-binding cassette, sub-family D (ALD), member 2)
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Recombinant fragment corresponding to a region within amino acids 338 and 588 of ABCD2 (Uniprot ID#Q9UBJ2) |
TAP2 Rabbit Polyclonal Antibody
Applications | ICC/IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human TAP2 |
Rabbit Monoclonal antibody against PMP70
Applications | Assay, FC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Rabbit Polyclonal Anti-ABCG2(CD338) Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-ABCG2(CD338) Antibody: Peptide sequence around aa.160~164( R-I-N-R-V) derived from Human ABCG2(CD338). |
Rabbit Polyclonal Anti-CFTR
Applications | IHC, WB |
Reactivities | Human, Rat |
Conjugation | Unconjugated |
Immunogen | Peptide (C)KEETEEEVQDTRL, corresponding to amino acid residues 1468-1480 of human CFTR . Cytoplasmic, C-terminal part. |
Rabbit Polyclonal ABCA1 Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat, Hamster |
Conjugation | Unconjugated |
Immunogen | Partial peptide sequence (peptide used resides somewhere between a.a 1100-1300) of the human ABCA1 gene. Actual immunogen sequence is proprietary information. |
Rabbit polyclonal anti-ABCB1 antibody
Applications | WB |
Reactivities | Human, Monkey, Mouse, Rat, Dog |
Conjugation | Unconjugated |
Immunogen | This affinity purified antibody was prepared from whole rabbit serum produced by repeated immunizations with a synthetic peptide corresponding to amino acids 262-277 of human ABCB1 protein. |
Rabbit Polyclonal ABCG1 Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat, Hamster |
Conjugation | Unconjugated |
Immunogen | A synthetic peptide made to an internal region of human ABCG1 (between residues 300-400). [UniProt# P45844] |
Rabbit anti-ABCD4 polyclonal antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide derived from Human ABCD4. |
Anti-ABCC5 Rabbit Polyclonal Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide corresponding to a region derived from 2-14 amino acids of Human ATP-binding cassette, sub-family C? |
Anti-ABCG2 Rabbit Polyclonal Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Peptide sequence around aa.160~164( R-I-N-R-V) derived from Human ABCG2(CD338). |
Anti-ABCA1 Rabbit Polyclonal Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Peptide sequence around aa.2253~2257(D-E-K-V-K) derived from Human ABCA1. |
Rabbit Polyclonal Anti-Abcb10 Antibody
Applications | WB |
Reactivities | Rat |
Conjugation | Unconjugated |
Immunogen | The immunogen for Anti-Abcb10 Antibody: synthetic peptide corresponding to a region of Rat. Synthetic peptide located within the following region: TRTGELINRLSSDTALLGHSVTENLSDGLRAVAQASVGVGMMFFVSPSLA |
Anti-ABCB9 Rabbit Polyclonal Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide peptide corresponding to a region derived from 710-723 amino acids of human ATP-binding cassette, sub-family B (MDR/TAP), member 9 |
Anti-ABCB8 Rabbit Polyclonal Antibody
Applications | ELISA, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Fusion protein corresponding to a region derived from 394-693 amino acids of Human ATP-binding cassette sub-family B member 8 |
Anti-ABCB8 Rabbit Polyclonal Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Fusion protein corresponding to a region derived from 394-693 amino acids of Human ATP-binding cassette sub-family B member 8 |
Anti-ABCC5 Rabbit Polyclonal Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide corresponding to a region derived from 2-14 amino acids of Human ATP-binding cassette, sub-family C? |
Anti-ABCB6 rabbit polyclonal antibody
Applications | ELISA, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Fusion protein corresponding to a region derived from 590-824 amino acids of human ATP-binding cassette, sub-family B (MDR/TAP), member 6 |
Anti-ABCB6 Rabbit Polyclonal Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Fusion protein corresponding to a region derived from 590-824 amino acids of human ATP-binding cassette, sub-family B (MDR/TAP), member 6 |
Anti-ABCD4 Rabbit Polyclonal Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide corresponding to a region derived from 137-149 amino acids of human ATP-binding cassette, sub-family D (ALD), member 4 |
Anti-ABCD4 Rabbit Polyclonal Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide corresponding to a region derived from 137-149 amino acids of human ATP-binding cassette, sub-family D (ALD), member 4 |
Anti-ABCC1 Rabbit Polyclonal Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide corresponding to a region derived from 625-638 amino acids of human ATP-binding cassette, sub-family C (CFTR/MRP), member 1 |
Anti-ABCG1 Rabbit Polyclonal Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide corresponding to a region derived from 349-362 amino acids of human ATP-binding cassette, sub-family G (WHITE), member 1 |
Anti-ABCG2 Rabbit Polyclonal Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide corresponding to a region derived from 609-621 amino acids of Human ATP-binding cassette sub-family G member 2 |
Anti-CFTR Rabbit Polyclonal Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide corresponding to a region derived from 681-897 amino acids of Human Cystic fibrosis transmembrane conductance regulator |
Anti-ABCG4 Rabbit Polyclonal Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Fusion protein corresponding to N terminal 250 amino acids of human ATP-binding cassette, sub-family G (WHITE), member 4 |
Anti-ABCB5 Rabbit Polyclonal Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Fusion protein corresponding to a region derived from 563-812 amino acids of Human ATP-binding cassette sub-family B member 5 |
Rabbit Polyclonal Anti-ABCC9 Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide of human ABCC9 |
Rabbit Polyclonal Anti-TAP2 Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide of human TAP2 |
Rabbit Polyclonal Anti-ABCC1 Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide of human ABCC1 |
Rabbit Polyclonal anti-ABCB1 Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human ABCB1 |
Rabbit Polyclonal anti-ABCB1 Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human ABCB1 |