Rabbit Polyclonal Anti-TCF7L1 Antibody - N-terminal region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-TCF7L1 antibody: synthetic peptide directed towards the N terminal of human TCF7L1. Synthetic peptide located within the following region: ESENQSSSSDSEAERRPQPVRDTFQKPRDYFAEVRRPQDSAFFKGPPYPG |
Rabbit polyclonal Catenin-beta (Tyr489) antibody(Phospho-specific)
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human Catenin-β around the phosphorylation site of tyrosine 489 (L-H-YP-G-L). |
| Modifications | Phospho-specific |
Rabbit Polyclonal Anti-TCF7L2 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-TCF7L2 Antibody: synthetic peptide directed towards the N terminal of human TCF7L2. Synthetic peptide located within the following region: MPQLNGGGGDDLGANDELISFKDEGEQEEKSSENSSAERDLADVKSSLVN |
Rabbit polyclonal anti-TCF7L1 antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from internal of human TCF7L1. |
Rabbit Polyclonal Anti-TCF7 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-TCF7 antibody is: synthetic peptide directed towards the N-terminal region of Human TCF7. Synthetic peptide located within the following region: AGGGDDLGAPDELLAFQDEGEEQDDKSRDSAAGPERDLAELKSSLVNESE |
Rabbit polyclonal Catenin-beta (Ab-489) antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized non-phosphopeptide derived from human Catenin-β around the phosphorylation site of tyrosine 489 (L-H-YP-G-L). |
Rabbit polyclonal beta Catenin antibody
| Applications | IHC, WB |
| Reactivities | Bovine, Human, Mouse, Rat, Xenopus, Zebrafish |
| Conjugation | Unconjugated |
| Immunogen | beta catenin antibody was prepared from whole rabbit serum produced by repeated immunizations with a synthetic peptide corresponding to catenin beta-1 C-terminus. |
Anti-TCF7 Rabbit Polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide corresponding to a region derived from 255-268 amino acids of human transcription factor 7 (T-cell specific, HMG-box) |
Rabbit Polyclonal Catenin-β Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against A synthesized peptide derived from human Catenin-β |
Rabbit Polyclonal Catenin- beta (Ser33) Antibody (Phospho-specific)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against A synthesized peptide derived from human Catenin- beta around the phosphorylation site of Serine 33 |
| Modifications | Phospho-specific |
Rabbit Polyclonal Catenin- beta (Tyr489) Antibody (Phospho-specific)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against A synthesized peptide derived from human Catenin- beta around the phosphorylation site of Tyrosine 489 |
| Modifications | Phospho-specific |
Rabbit Polyclonal Catenin-β (Ser37) Antibody (Phospho-specific)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against A synthesized peptide derived from human Catenin-β around the phosphorylation site of Serine 37 |
| Modifications | Phospho-specific |
Rabbit Polyclonal Anti-LEF1 Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-LEF1 antibody: synthetic peptide directed towards the C terminal of human LEF1. Synthetic peptide located within the following region: VKPQHEQRKEQEPKRPHIKKPLNAFMLYMKEMRANVVAECTLKESAAINQ |
Rabbit polyclonal Catenin-beta (Ab-552) antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from Internalof human CTNNB1. |
Rabbit polyclonal beta-Catenin (Ser37) antibody(Phospho-specific)
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human β-Catenin around the phosphorylation site of serine 37 (I-H-SP-G-A). |
| Modifications | Phospho-specific |
Rabbit polyclonal anti-TCF7 antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from N-terminal of human TCF7. |
Rabbit polyclonal LEF1 Antibody (N-term)
| Applications | IF, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This LEF1 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 10-37 amino acids from the N-terminal region of human LEF1. |
Rabbit Polyclonal anti-TCF7L1 antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-TCF7L1 antibody: synthetic peptide directed towards the N terminal of human TCF7L1. Synthetic peptide located within the following region: NDELIPFQDEGGEEQEPSSDSASAQRDLDEVKSSLVNESENQSSSSDSEA |
Rabbit Polyclonal Anti-CTNNB1 Antibody
| Applications | Assay, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-CTNNB1 antibody: synthetic peptide directed towards the middle region of human CTNNB1. Synthetic peptide located within the following region: RTEPMAWNETADLGLDIGAQGEPLGYRQDDPSYRSFHSGGYGQDALGMDP |
Rabbit Polyclonal Anti-CTNNB1 Antibody
| Applications | Assay, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-CTNNB1 antibody is: synthetic peptide directed towards the C-terminal region of Human CTNNB1. Synthetic peptide located within the following region: LGLDIGAQGEPLGYRQDDPSYRSFHSGGYGQDALGMDPMMEHEMGGHHPG |
Rabbit Polyclonal Anti-TCF7 Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-TCF7 antibody: synthetic peptide directed towards the middle region of human TCF7. Synthetic peptide located within the following region: PAAIPHPAIVPPSGKQELQPFDRNLKTQAESKAEKEAKKPTIKKPLNAFM |
Rabbit Polyclonal Catenin- beta (Thr41/Ser45) Antibody (Phospho-specific)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against A synthesized peptide derived from human Catenin- beta around the phosphorylation site of Threonine 41/Serine 45 |
| Modifications | Phospho-specific |
Rabbit Polyclonal anti-TCF7 antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-TCF7 antibody: synthetic peptide directed towards the middle region of human TCF7. Synthetic peptide located within the following region: MQLYPGWSARDNYGKKKRRSREKHQESTTETNWPRELKDGNGQESLSMSS |
Rabbit Polyclonal anti-TCF7 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-TCF7 antibody is: synthetic peptide directed towards the C-terminal region of Human TCF7. Synthetic peptide located within the following region: AKYYELARKERQLHMQLYPGWSARDNYGKKKRRSREKHQESTTDNSLHYS |
Rabbit Polyclonal Anti-LEF1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-LEF1 antibody: synthetic peptide directed towards the N terminal of human LEF1. Synthetic peptide located within the following region: VARQAQTSQEPYHDKAREHPDDGKHPDGGLYNKGPSYSSYSGYIMMPNMN |
Rabbit Polyclonal Anti-TCF7 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-TCF7 antibody: synthetic peptide directed towards the C terminal of human TCF7. Synthetic peptide located within the following region: YLPGEGRCPSPVPSDDSALGCPGSPAPQDSPSYHLLPRFPTELLTSPAER |
Rabbit Polyclonal Anti-LEF1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-LEF1 antibody: synthetic peptide directed towards the middle region of human LEF1. Synthetic peptide located within the following region: ADIKSSLVNESEIIPASNGHEVARQAQTSQEPYHDKAREHPDDGKHPDGG |
Rabbit Polyclonal Anti-TCF7L2 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-TCF7L2 Antibody: synthetic peptide directed towards the middle region of human TCF7L2. Synthetic peptide located within the following region: GGFRHPYPTALTVNASMSRFPPHMVPPHHTLHTTGIPHPAIVTPTVKQES |
Rabbit Polyclonal Anti-TCF7 Antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-TCF7 antibody: synthetic peptide directed towards the N terminal of human TCF7. Synthetic peptide located within the following region: PQPQPPLHKANQPPHGVPQLSLYEHFNSPHPTPAPADISQKQVHRPLQTP |
Rabbit anti Catenin beta Polyclonal Antibody
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Rabbit anti Catenin-b (pS675) Polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | A synthetic peptide corresponding to the epitope –KRLSVEL- with a single phosphorylation site Ser675 of human b-catenin. |
Rabbit anti Catenin-beta (pS33) Polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | A synthetic peptide corresponding to the epitope SGIHS with a single phosphorylation site Ser33 of human b-catenin. |
Rabbit anti Catenin-beta (pS33/37) Polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | A synthetic peptide corresponding to the epitope SGIHS with dually phosphorylation sites Ser33/Ser37 of human b-catenin. |
Rabbit anti Catenin-beta (Paired 33/37) Polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | A synthetic peptide corresponding to the epitope SGIHS without phosphorylation of human b-catenin |
Rabbit anti Catenin-beta (pS37) Polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | A synthetic peptide corresponding to the epitope SGIHS with a single phosphorylation site Ser37 of human b-catenin. |
Germany
Japan
United Kingdom
China
