Antibodies

Jump to Filters
View as table Download
ALX4 (Center) Rabbit Polyclonal Antibody
AP50156PU-N

USD 450.00

2 Weeks

ALX4 (Center) rabbit polyclonal antibody, Aff - Purified

Applications FC, WB
Reactivities Human
Immunogen KLH conjugated synthetic peptide between 256-283 amino acids from the Central region of human ALX4
ALX4 Rabbit Polyclonal Antibody
TA330266

USD 375.00

5 Days

Rabbit Polyclonal Anti-ALX4 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-ALX4 antibody: synthetic peptide directed towards the N terminal of human ALX4. Synthetic peptide located within the following region: MESSAKMESGGAGQQPQPQPQQPFLPPAACFFATAAAAAAAAAAAAAQSA
ALX4 Rabbit Polyclonal Antibody
TA331782

USD 375.00

5 Days

Rabbit Polyclonal Anti-ALX4 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-ALX4 Antibody: synthetic peptide directed towards the middle region of human ALX4. Synthetic peptide located within the following region: GQTHMGSLFGAASLSPGLNGYELNGEPDRKTSSIAALRMKAKEHSAAISW
ALX4 Rabbit Polyclonal Antibody
TA331783

USD 375.00

5 Days

Rabbit Polyclonal Anti-ALX4 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-ALX4 Antibody: synthetic peptide directed towards the N terminal of human ALX4. Synthetic peptide located within the following region: MNAETCVSYCESPAAAMDAYYSPVSQSREGSSPFRAFPGGDKFGTTFLSA
ALX4 Rabbit Polyclonal Antibody
TA341710

USD 310.00

5 Days

Rabbit Polyclonal Anti-ALX4 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-ALX4 antibody: synthetic peptide directed towards the N terminal of human ALX4. Synthetic peptide located within the following region: SSPFRAFPGGDKFGTTFLSAAAKAQGFGDAKSRARYGAGQQDLATPLESG
ALX4 Rabbit Polyclonal Antibody
TA341711

USD 375.00

5 Days

Rabbit Polyclonal Anti-ALX4 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-ALX4 antibody: synthetic peptide directed towards the C terminal of human ALX4. Synthetic peptide located within the following region: SVSGAGSHVGQTHMGSLFGAASLSPGLNGYELNGEPDRKTSSIAALRMKA
ALX4 Rabbit Polyclonal Antibody
TA341743

USD 375.00

5 Days

Rabbit Polyclonal Anti-Alx4 Antibody

Applications WB
Reactivities Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-Alx4 antibody: synthetic peptide directed towards the middle region of mouse Alx4. Synthetic peptide located within the following region: EPELPPDSEPVGMDNSYLSVKETGAKGPQDRASAEIPSPLEKTDSESNKG
ALX4 Rabbit Polyclonal Antibody
TA350626

USD 345.00

In Stock

Rabbit Polyclonal Anti-ALX4 Antibody

Applications IHC
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Synthetic peptide of human ALX4