Antibodies

View as table Download

GRPR Rabbit Polyclonal (Extracellular Domain) Antibody

Applications IHC
Reactivities Bat, Gibbon, Dog, Gorilla, Horse, Human, Monkey, Pig, Rabbit
Conjugation Unconjugated
Immunogen GRPR antibody was raised against synthetic 18 amino acid peptide from 2nd extracellular domain of human GRPR. Percent identity with other species by BLAST analysis: Human, Gorilla, Gibbon, Monkey, Marmoset, Elephant, Panda, Dog, Bat, Horse, Rabbit, Pig (100%); Bovine (94%); Mouse, Rat, Hamster (83%).

Dopamine Receptor D3 / DRD3 Rabbit Polyclonal (Cytoplasmic Domain) Antibody

Applications IHC
Reactivities Chimpanzee, Gorilla, Human, Monkey
Conjugation Unconjugated
Immunogen DRD3 / Dopamine Receptor D3 antibody was raised against synthetic 16 amino acid peptide from 3rd cytoplasmic domain of human DRD3 / Dopamine Receptor D3. Percent identity with other species by BLAST analysis: Human, Chimpanzee, Gorilla, Monkey, Marmoset (100%); Gibbon, Mouse, Dog, Bovine, Bat, Hamster, Elephant, Panda, Horse, Rabbit (94%); Rat, Pig, Opossum (88%).

Rabbit Polyclonal antibody to Ribosome binding protein 1 (ribosome binding protein 1 homolog 180kDa (dog))

Applications IF, IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Recombinant fragment corresponding to a region within amino acids 1183 and 1410 of Ribosome binding protein 1 (Uniprot ID#Q9P2E9)

Rabbit Polyclonal antibody to TRAM1 (translocation associated membrane protein 1)

Applications IF, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region within amino acids 310 and 374 of TRAM1 (Uniprot ID#Q15629)

Rabbit polyclonal antibody to CD41/Integrin alpha 2b (integrin, alpha 2b (platelet glycoprotein IIb of IIb/IIIa complex, antigen CD41))

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Recombinant fragment corresponding to a region within amino acids 210 and 532 of Integrin alpha 2b (Uniprot ID#P08514)

GPR183 / EBI2 Rabbit Polyclonal (C-Terminus) Antibody

Applications IHC
Reactivities Gorilla, Human
Conjugation Unconjugated
Immunogen GPR183 / EBI2 antibody was raised against synthetic 15 amino acid peptide from C-terminus of human GPR183 / EBI2. Percent identity with other species by BLAST analysis: Human, Gorilla, Monkey (100%); Marmoset, Mouse, Rat, Hamster, Elephant, Panda, Dog, Bat, Bovine, Horse, Rabbit, Pig (93%); Opossum, Platypus, Catfish, Zebrafish (80%).

Rabbit Polyclonal Antibody against Derlin-1

Applications IHC, WB
Reactivities Human, Dog
Conjugation Unconjugated
Immunogen A synthetic peptide made to the C-terminal region of the human Derlin-1 protein sequence (between residues 200-251).

Rabbit Polyclonal antibody to SEC61A1 (Sec61 alpha 1 subunit (S. cerevisiae))

Applications IF, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region within amino acids 413 and 476 of SEC61A1

Rabbit Polyclonal antibody to Caveolin 2 (caveolin 2)

Applications IF, IHC, IP, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region within amino acids 1 and 45 of Caveolin 2

Rabbit Polyclonal antibody to alpha 1a Adrenergic Receptor (adrenergic, alpha-1A-, receptor)

Applications IF, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Synthetic peptide contain a sequence corresponding to a region within amino acids 206 and 260 of alpha 1a Adrenergic Receptor (Uniprot ID#P35348)

Rabbit Polyclonal antibody to DNase I (deoxyribonuclease I)

Applications IF, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Recombinant fragment corresponding to a region within amino acids 1 and 282 of DNase I (Uniprot ID#P24855)

CHRM3 / M3 Rabbit Polyclonal (C-Terminus) Antibody

Applications IHC
Reactivities Gibbon, Gorilla, Human, Monkey, Orang-Utan
Conjugation Unconjugated
Immunogen CHRM3 / M3 antibody was raised against synthetic 19 amino acid peptide from C-terminus of human CHRM3 / M3. Percent identity with other species by BLAST analysis: Human, Gorilla, Orangutan, Gibbon, Monkey (100%); Chimpanzee, Mouse, Rat, Sheep, Hamster, Elephant, Dog, Bovine, Horse, Rabbit, Pig, Guinea pig (95%); Opossum, Turkey, Chicken, Lizard (89%).

Rabbit Polyclonal Antibody against Carbonic Anhydrase IX

Applications IHC, WB
Reactivities Human, Dog
Conjugation Unconjugated
Immunogen A synthetic peptide derived from a C-terminal sequence of the human CA IX.

Rabbit polyclonal antibody to GAL3ST1 (galactose-3-O-sulfotransferase 1)

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Recombinant fragment corresponding to a region within amino acids 1 and 412 of GAL3ST1 (Uniprot ID#Q99999)

Rabbit Polyclonal antibody to BCL-x (BCL2-like 1)

Applications IF, IHC, IP, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Recombinant fragment corresponding to a region within amino acids 1 and 208 of Bcl-X (Uniprot ID#Q07817)

CALCRL / CRLR Rabbit Polyclonal (Cytoplasmic Domain) Antibody

Applications IHC
Reactivities Gibbon, Bovine, Dog, Xenopus, Gorilla, Goat, Hamster, Horse, Human, Monkey, Orang-Utan, Pig, Rabbit, Rat
Conjugation Unconjugated
Immunogen CALCRL / CGRP Receptor antibody was raised against synthetic 16 amino acid peptide from 3rd cytoplasmic domain of human CALCRL. Percent identity with other species by BLAST analysis: Human, Gorilla, Orangutan, Gibbon, Monkey, Marmoset, Rat, Goat, Hamster, Panda, Dog, Bovine, Horse, Rabbit, Pig, Opossum, Xenopus (100%); Mouse, Elephant, Bat, Guinea pig, Stickleback, Pufferfish, Zebrafish (94%); Turkey, Chicken (81%).

ILEI / FAM3C Rabbit Polyclonal (aa40-80) Antibody

Applications IHC
Reactivities Bovine, Chimpanzee, Chicken, Human, Monkey, Mouse, Opossum, Rat, Dog, Pufferfish
Conjugation Unconjugated
Immunogen ILEI / FAM3C antibody was raised against synthetic peptide from human FAM3C.

Anti-Hepsin Rabbit Polyclonal Antibody

Applications IHC
Reactivities Bat, Gibbon, Bovine, Dog, Gorilla, Human, Monkey, Orang-Utan, Rabbit
Conjugation Unconjugated
Immunogen HPN / TMPRSS1 / Hepsin antibody was raised against human hepsin amino acids 241-260 (GGYLPFRDPNSEENSNDIAL). Percent identity by BLAST analysis: Human, Gorilla, Orangutan, Gibbon, Monkey, Marmoset, Bovine, Dog, Bat, Panda, Rabbit (100%); Opossum (95%); Hamster, Horse (90%); Mouse, Rat (85%); Xenopus (80%).

ZIP14 / SLC39A14 Rabbit Polyclonal (Internal) Antibody

Applications IHC
Reactivities Bat, Chimpanzee, Dog, Gorilla, Horse, Human, Pig
Conjugation Unconjugated
Immunogen SLC39A14 / ZIP14 antibody was raised against synthetic 15 amino acid peptide from internal region of human SLC39A14. Percent identity with other species by BLAST analysis: Human, Chimpanzee, Gorilla, Panda, Dog, Bat, Horse, Pig (100%); Orangutan, Gibbon, Monkey, Galago, Marmoset, Mouse, Hamster, Bovine (93%); Elephant (87%); Rat, Rabbit, Guinea pig (80%).

ZIP14 / SLC39A14 Rabbit Polyclonal (Cytoplasmic Domain) Antibody

Applications IHC
Reactivities Gibbon, Gorilla, Human, Monkey, Orang-Utan, Pig
Conjugation Unconjugated
Immunogen SLC39A14 / ZIP14 antibody was raised against synthetic 15 amino acid peptide from cytoplasmic domain of human SLC39A14. Percent identity with other species by BLAST analysis: Human, Gorilla, Orangutan, Gibbon, Monkey, Marmoset, Pig (100%); Bovine, Dog, Hamster, Elephant, Panda (93%); Rat, Bat, Rabbit, Horse, Opossum (87%); Mouse (80%).

GPRC6A Rabbit Polyclonal (N-Terminus) Antibody

Applications IHC
Reactivities Gorilla, Human, Monkey
Conjugation Unconjugated
Immunogen GPRC6A antibody was raised against synthetic 17 amino acid peptide from N-terminal extracellular domain of human GPRC6A. Percent identity with other species by BLAST analysis: Human, Gorilla, Monkey, Panda (100%); Dog, Elephant, Rabbit, Horse, Pig (94%); Marmoset, Mouse, Rat, Bovine, Hamster (82%).

CCR4 Rabbit Polyclonal (C-Terminus) Antibody

Applications IHC
Reactivities Gibbon, Gorilla, Human
Conjugation Unconjugated
Immunogen CCR4 antibody was raised against synthetic 18 amino acid peptide from C-terminus of human CCR4. Percent identity with other species by BLAST analysis: Human, Gorilla, Gibbon, Monkey (100%); Marmoset, Panda, Dog (94%); Hamster, Elephant, Bovine, Horse (89%); Bat, Rabbit, Opossum (83%).

Rabbit Polyclonal Anti-KCNK13 Antibody

Applications IHC, WB
Reactivities Human, Dog
Conjugation Unconjugated
Immunogen The immunogen for anti-KCNK13 antibody: synthetic peptide directed towards the C terminal of human KCNK13. Synthetic peptide located within the following region: GEMISMKDLLAANKASLAILQKQLSEMANGCPHQTSTLARDNEFSGGVGA

Rabbit Polyclonal antibody to XPR1 (xenotropic and polytropic retrovirus receptor)

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region within amino acids 1 and 45 of XPR1 (Uniprot ID#Q9UBH6)

Rabbit Polyclonal antibody to beta Amyloid (amyloid beta (A4) precursor protein)

Applications IF, IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Recombinant fragment corresponding to a region within amino acids 602 and 770 of beta Amyloid (Uniprot ID#P05067)

GLG1 / MG160 Rabbit Polyclonal (Internal) Antibody

Applications IHC
Reactivities Bat, Bovine, Chicken, Hamster, Human, Monkey, Mouse, Rabbit, Rat, Xenopus, Zebrafish, Gorilla, Dog, Horse, Gibbon
Conjugation Unconjugated
Immunogen GLG1 / MG160 antibody was raised against synthetic 18 amino acid peptide from internal region of human GLG1. Percent identity with other species by BLAST analysis: Human, Gorilla, Gibbon, Monkey, Marmoset, Mouse, Rat, Dog, Bat, Bovine, Hamster, Elephant, Panda, Horse, Rabbit, Opossum, Turkey, Chicken, Xenopus, Zebrafish (100%); Stickleback (89%).

ITGA3 / CD49c Rabbit Polyclonal (N-Terminus) Antibody

Applications IHC
Reactivities Bovine, Gorilla, Human
Conjugation Unconjugated
Immunogen ITGA3 / CD49c antibody was raised against synthetic 18 amino acid peptide from N-terminus of human ITGA3 / CD49c. Percent identity with other species by BLAST analysis: Human, Gorilla, Monkey, Bovine (100%); Marmoset, Mouse, Dog, Bat, Hamster, Elephant, Horse, Opossum (94%); Rabbit (89%).

GluT-1 / GLAST Rabbit Polyclonal (Cytoplasmic Domain) Antibody

Applications IHC
Reactivities Gibbon, Bovine, Gorilla, Hamster, Horse, Human, Monkey, Mouse, Pig, Rabbit, Rat
Conjugation Unconjugated
Immunogen SLC1A3 / GluT-1 / GLAST antibody was raised against synthetic 19 amino acid peptide from cytoplasmic domain of human SLC1A3 / GLAST. Percent identity with other species by BLAST analysis: Human, Gorilla, Gibbon, Monkey, Marmoset, Mouse, Rat, Hamster, Elephant, Bovine, Horse, Rabbit, Pig (100%); Panda, Dog, Opossum, Guinea pig, Turkey, Chicken (95%); Xenopus (84%).

GPR4 Rabbit Polyclonal (Extracellular Domain) Antibody

Applications IHC
Reactivities Bat, Bovine, Human, Monkey, Mouse, Rabbit, Rat, Dog, Pig, Gibbon
Conjugation Unconjugated
Immunogen GPR4 antibody was raised against synthetic 20 amino acid peptide from 2nd extracellular domain of human GPR4. Percent identity with other species by BLAST analysis: Human, Gibbon, Monkey, Mouse, Rat, Dog, Bat, Bovine, Panda, Rabbit, Pig (100%); Zebrafish (85%); Pufferfish, Stickleback (80%).

GPR4 Rabbit Polyclonal (C-Terminus) Antibody

Applications IHC
Reactivities Gibbon, Dog, Gorilla, Human, Monkey
Conjugation Unconjugated
Immunogen GPR4 antibody was raised against synthetic 19 amino acid peptide from C-terminus of human GPR4. Percent identity with other species by BLAST analysis: Human, Gorilla, Gibbon, Monkey, Dog, Panda (100%); Mouse, Rat, Bovine, Bat, Pig (95%); Rabbit (89%).

Rabbit polyclonal anti-ABCB1 antibody

Applications WB
Reactivities Human, Monkey, Mouse, Rat, Dog
Conjugation Unconjugated
Immunogen This affinity purified antibody was prepared from whole rabbit serum produced by repeated immunizations with a synthetic peptide corresponding to amino acids 262-277 of human ABCB1 protein.

Rabbit polyclonal anti-NOTCH 2 antibody

Applications IHC, WB
Reactivities Chimpanzee, Human, Dog
Conjugation Unconjugated
Immunogen This whole rabbit serum was prepared by repeated immunizations with a synthetic peptide corresponding to amino acid residues 2396-2409 of human Notch 2 (the total protein is 2471 aa). A residue of cysteine was added to the amino terminal end to facilitate coupling.

Rabbit polyclonal antibody to Sec61 gamma subunit (Sec61 gamma subunit)

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region within amino acids 2 and 66 of Sec61 gamma

GPR65 Rabbit Polyclonal (Cytoplasmic Domain) Antibody

Applications IHC
Reactivities Human
Conjugation Unconjugated
Immunogen GPR65 / TDAG8 antibody was raised against synthetic 16 amino acid peptide from 1st cytoplasmic domain of human GPR65. Percent identity with other species by BLAST analysis: Human, Gorilla, Gibbon, Monkey, Marmoset, Mouse, Rat, Dog, Bat, Panda, Horse, Pig (94%); Bovine, Hamster, Rabbit, Platypus (88%); Elephant, Opossum (81%).

GRPR Rabbit Polyclonal (Cytoplasmic Domain) Antibody

Applications IHC
Reactivities Bat, Gibbon, Bovine, Dog, Gorilla, Hamster, Human, Monkey, Mouse, Pig, Rat
Conjugation Unconjugated
Immunogen GRPR antibody was raised against synthetic 17 amino acid peptide from 3rd cytoplasmic domain of human GRPR. Percent identity with other species by BLAST analysis: Human, Gorilla, Gibbon, Monkey, Marmoset, Mouse, Rat, Hamster, Elephant, Bovine, Dog, Bat, Pig (100%); Panda, Rabbit, Opossum (94%); Horse (88%); Turkey, Chicken, Lizard (82%).

FKSG80 / GPR81 Rabbit Polyclonal (Extracellular Domain) Antibody

Applications IHC
Reactivities Bat, Dog, Gorilla, Hamster, Human, Monkey, Rabbit, Rat
Conjugation Unconjugated
Immunogen FKSG80 / GPR81 antibody was raised against synthetic 16 amino acid peptide from 2nd extracellular domain of human GPR81. Percent identity with other species by BLAST analysis: Human, Gorilla, Monkey, Marmoset, Rat, Dog, Bat, Hamster, Panda, Rabbit, Opossum (100%); Mouse, Horse, Pig, Platypus (94%); Bovine (88%); Elephant (81%).

HTR6 / 5-HT6 Rabbit Polyclonal (C-Terminus) Antibody

Applications IHC
Reactivities Gibbon, Chimpanzee, Dog, Gorilla, Hamster, Horse, Human, Monkey, Rat
Conjugation Unconjugated
Immunogen HTR6 / 5-HT6 Receptor antibody was raised against synthetic 17 amino acid peptide from C-terminus of human HTR6 / 5-HT36. Percent identity with other species by BLAST analysis: Human, Chimpanzee, Gorilla, Gibbon, Monkey, Marmoset, Rat, Hamster, Panda, Dog, Horse (100%); Mouse, Elephant, Bovine, Bat, Rabbit (94%); Stickleback, Pufferfish (88%); Turkey, Chicken, Xenopus, Zebrafish (82%).

KCNMA1 / BK Rabbit Polyclonal (Internal) Antibody

Applications IHC
Reactivities Bovine, Chicken, Hamster, Human, Monkey, Mouse, Rabbit, Rat, Xenopus, Zebrafish, Dog, Pig
Conjugation Unconjugated
Immunogen KCNMA1 / BK antibody was raised against synthetic 15 amino acid peptide from internal region of human KCNMA1. Percent identity with other species by BLAST analysis: Human, Monkey, Mouse, Rat, Hamster, Bovine, Dog, Rabbit, Pig, Turkey, Chicken, Xenopus, Seabass, Stickleback, Pufferfish, Zebrafish (100%).

PGES / PTGES Rabbit Polyclonal (N-Terminus) Antibody

Applications IHC
Reactivities Gibbon, Bovine, Chicken, Dog, Gorilla, Horse, Human, Monkey, Pig, Rabbit, Rat, Zebrafish
Conjugation Unconjugated
Immunogen PGES / PTGES antibody was raised against synthetic 14 amino acid peptide from near N-terminus of human PTGES. Percent identity with other species by BLAST analysis: Human, Gorilla, Gibbon, Monkey, Marmoset, Rat, Bovine, Dog, Elephant, Panda, Rabbit, Horse, Pig, Opossum, Turkey, Chicken, Platypus, Pufferfish, Zebrafish, Stickleback (100%); Mouse, Xenopus, Pike (93%).

TM9SF3 Rabbit Polyclonal (Internal) Antibody

Applications IHC
Reactivities Bovine, Chimpanzee, Chicken, Guinea Pig, Human, Monkey, Mouse, Orang-Utan, Rabbit, Rat, Xenopus, Gorilla, Dog, Pig, Horse, Gibbon
Conjugation Unconjugated
Immunogen TM9SF3 antibody was raised against synthetic 15 amino acid peptide from internal region of human TM9SF3. Percent identity with other species by BLAST analysis: Human, Chimpanzee, Gorilla, Orangutan, Gibbon, Monkey, Galago, Marmoset, Mouse, Rat, Elephant, Panda, Bovine, Dog, Horse, Rabbit, Pig, Opossum, Guinea pig, Turkey, Zebra finch, Chicken, Platypus, Xenopus (100%); Lizard, Stickleback, Medaka (93%); Bat, Salmon, Zebrafish, Eye worm, Tick (87%); Pufferfish, Drosophila, Water flea, Nematode (80%).

TM9SF3 Rabbit Polyclonal (Internal) Antibody

Applications IHC
Reactivities Bat, Bovine, Chicken, Hamster, Human, Monkey, Mouse, Rabbit, Rat, Xenopus, Zebrafish, Gorilla, Dog, Pig, Horse, Gibbon
Conjugation Unconjugated
Immunogen TM9SF3 antibody was raised against synthetic 17 amino acid peptide from internal region of human TM9SF3. Percent identity with other species by BLAST analysis: Human, Gorilla, Gibbon, Monkey, Marmoset, Mouse, Rat, Bovine, Dog, Bat, Hamster, Elephant, Panda, Horse, Rabbit, Pig, Turkey, Chicken, Platypus, Xenopus, Pufferfish, Zebrafish (100%); Salmon, Stickleback (94%); Opossum, Seq squirt (82%).

TMEM33 Rabbit Polyclonal (Internal) Antibody

Applications IHC
Reactivities Bat, Gibbon, Bovine, Dog, Gorilla, Horse, Human, Monkey, Pig
Conjugation Unconjugated
Immunogen TMEM33 antibody was raised against synthetic 18 amino acid peptide from internal region of human TMEM33. Percent identity with other species by BLAST analysis: Human, Gorilla, Gibbon, Monkey, Marmoset, Bovine, Dog, Bat, Elephant, Panda, Horse, Pig, Opossum, Platypus (100%); Mouse, Rat, Hamster, Rabbit, Turkey, Chicken, Lizard, Xenopus, Zebrafish (94%); Catfish, Salmon, Stickleback, Sea anemone (89%); Drosophila (83%).

WNT7A Rabbit Polyclonal (Internal) Antibody

Applications IHC
Reactivities Bat, Bovine, Chimpanzee, Chicken, Guinea Pig, Hamster, Human, Monkey, Mouse, Orang-Utan, Rabbit, Rat, Xenopus, Gorilla, Dog, Pig, Horse, Gibbon
Conjugation Unconjugated
Immunogen WNT7A antibody was raised against synthetic 12 amino acid peptide from internal region of human WNT7A. Percent identity with other species by BLAST analysis: Human, Chimpanzee, Gorilla, Orangutan, Gibbon, Monkey, Galago, Marmoset, Mouse, Rat, Hamster, Elephant, Panda, Bovine, Dog, Bat, Horse, Rabbit, Pig, Guinea pig, Turkey, Zebra finch, Chicken, Platypus, Lizard, Xenopus (100%); Seabass (92%); Stickleback, Pufferfish, Zebrafish (83%).

NPFF1 / NPFFR1 Rabbit Polyclonal (Extracellular Domain) Antibody

Applications IHC
Reactivities Gibbon, Bovine, Gorilla, Horse, Human, Monkey, Pig, Rabbit
Conjugation Unconjugated
Immunogen NPFFR1 / GPR147 antibody was raised against synthetic 20 amino acid peptide from 2nd extracellular domain of human NPFF1 Receptor. Percent identity with other species by BLAST analysis: Human, Gorilla, Gibbon, Monkey, Marmoset, Bovine, Horse, Rabbit, Pig (100%); Mouse, Rat, Dog, Panda (95%); Elephant, Turkey, Chicken (85%); Opossum, Platypus (80%).

CNR2 / CB2 Rabbit Polyclonal (Cytoplasmic Domain) Antibody

Applications IHC
Reactivities Gibbon, Dog, Gorilla, Human, Monkey
Conjugation Unconjugated
Immunogen CNR2 / CB2 antibody was raised against synthetic 20 amino acid peptide from 3rd cytoplasmic domain of human CNR2 / CB2. Percent identity with other species by BLAST analysis: Human, Gorilla, Gibbon, Monkey, Marmoset, Dog (100%); Mouse, Rat, Elephant, Panda (95%); Hamster, Bat, Horse (90%); Rabbit (85%).

Alpha 1b / ADRA1B Rabbit Polyclonal (Cytoplasmic Domain) Antibody

Applications IHC
Reactivities Gibbon, Bovine, Dog, Gorilla, Hamster, Horse, Human, Monkey, Mouse, Pig, Rat
Conjugation Unconjugated
Immunogen ADRA1B antibody was raised against synthetic 16 amino acid peptide from 3rd cytoplasmic domain of human ADRA1B. Percent identity with other species by BLAST analysis: Human, Gorilla, Gibbon, Monkey, Marmoset, Mouse, Rat, Bovine, Dog, Hamster, Elephant, Panda, Horse, Pig, Opossum (100%); Bat (94%); Turkey, Chicken (88%); Platypus (81%).

KCNH2 / HERG Rabbit Polyclonal (Internal) Antibody

Applications IHC
Reactivities Gibbon, Bovine, Dog, Hamster, Horse, Human, Monkey, Mouse, Pig, Rabbit, Rat
Conjugation Unconjugated
Immunogen KCNH2 / HERG antibody was raised against synthetic 16 amino acid peptide from internal region of human KCNH2 / Kv11.1. Percent identity with other species by BLAST analysis: Human, Gibbon, Monkey, Marmoset, Mouse, Rat, Hamster, Elephant, Panda, Bovine, Dog, Horse, Rabbit, Pig (100%); Bat, Guinea pig (94%).

ENTPD2 Rabbit Polyclonal (Internal) Antibody

Applications IHC
Reactivities Gorilla, Human
Conjugation Unconjugated
Immunogen ENTPD2 antibody was raised against synthetic 17 amino acid peptide from internal region of human ENTPD2. Percent identity with other species by BLAST analysis: Human, Gorilla (100%); Gibbon, Monkey, Panda, Dog, Horse (94%); Marmoset, Mouse, Rat, Hamster, Elephant, Bovine (88%); Opossum, Xenopus (82%).

Rabbit Polyclonal Antibody against STIM-1

Applications WB
Reactivities Human, Mouse, Rat, Bovine, Dog
Conjugation Unconjugated
Immunogen A synthetic peptide made to a C-terminal region (within residues 600-685) of the human protein. [Uniprot# Q13586]

Rabbit polyclonal antibody to IL-12 Receptor beta2 (interleukin 12 receptor, beta 2)

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Recombinant fragment corresponding to a region within amino acids 323 and 695 of IL-12 Receptor beta2 (Uniprot ID#Q99665)