Germany
Japan
United Kingdom
China
Antibodies
View as table Download
Rabbit Polyclonal Anti-UCRC Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-UCRC antibody: synthetic peptide directed towards the middle region of human UCRC. Synthetic peptide located within the following region: LFRRTSTFALTIIVGVMFFERAFDQGADAIYDHINEGKLWKHIKHKYENK |
Rabbit polyclonal anti-NDUFA4L2 antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from internal of human NDUFA4L2. |
Rabbit polyclonal anti-COX IV antibody, Loading control
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Bovine, Primate, Rat |
| Conjugation | Unconjugated |
| Immunogen | A synthetic peptide made to an internal region of the human COX4-1 protein (within residues 1-100). [Swiss-Prot# P13073] |
Rabbit anti-SLC25A4 Polyclonal Antibody
| Applications | ICC/IF, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human SLC25A4 |
COX7A1 (Center) rabbit polyclonal antibody, Aff - Purified
| Applications | WB |
| Reactivities | Human, Mouse |
| Immunogen | KLH conjugated synthetic peptide between 9-38 amino acids from the Central region of human COX7A1 |
Rabbit anti-HTRA2 Polyclonal Antibody
| Applications | IF, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human HTRA2 |
Rabbit polyclonal anti-GPR37 antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from internal of human GPR37. |
Rabbit polyclonal anti-NDUFA4 antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from internal of human NDUFA4. |
COX7A2 Rabbit Polyclonal (N-Terminus) Antibody
| Applications | IHC |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | COX7A2 antibody was raised against synthetic peptide from human COX7S/A2 (aa1-50). |
Rabbit polyclonal SLC25A31 Antibody (Center)
| Applications | IF, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This SLC25A31 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 139-167 amino acids from the Central region of human SLC25A31. |
Rabbit polyclonal SLC25A6 Antibody (Center)
| Applications | FC, IF, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This SLC25A6 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 128-155 amino acids from the Central region of human SLC25A6. |
Rabbit Polyclonal Anti-SLC25A6 Antibody - N-terminal region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-SLC25A6 antibody: synthetic peptide directed towards the N terminal of human SLC25A6. Synthetic peptide located within the following region: LQVQHASKQIAADKQYKGIVDCIVRIPKEQGVLSFWRGNLANVIRYFPTQ |
Rabbit Polyclonal Anti-SLC18A1 Antibody - N-terminal region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-SLC18A1 antibody is: synthetic peptide directed towards the N-terminal region of Human SLC18A1. Synthetic peptide located within the following region: FKEVNSSLHLGHAGSSPHALASPAFSTIFSFFNNNTVAVEESVPSGIAWM |
Rabbit Polyclonal Anti-ATP5G2 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-ATP5G2 antibody: synthetic peptide directed towards the N terminal of human ATP5G2. Synthetic peptide located within the following region: SRPLSAVVLKRPEILTDESLSSLAVSCPLTSLVSSRSFQTSAISRDIDTA |
Rabbit Polyclonal Anti-COX42 Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-COX42 Antibody: A synthesized peptide derived from human COX42 |
Rabbit Polyclonal Anti-COX6C Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-COX6C Antibody: A synthesized peptide derived from human COX6C |
Rabbit Polyclonal Anti-COX IV antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-COX IV antibody: A synthesized peptide derived from human COX IV |
Rabbit Polyclonal antibody to NDUFB5 (NADH dehydrogenase (ubiquinone) 1 beta subcomplex, 5, 16kDa)
| Applications | IF, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide corresponding to a region within amino acids 126 and 189 of NDUFB5 (Uniprot ID#O43674) |
Rabbit Anti-Dopamine Transporter, C-Terminus, Human Antibody
| Applications | WB |
| Reactivities | Human, Monkey, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide corresponding to amino acid residues from the intracellular C-terminal region conjugated to KLH |
Rabbit Anti-Dopamine Transporter, Extracellular Loop 2, Human Antibody
| Applications | WB |
| Reactivities | Human, Monkey |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide corresponding to amino acid residues from the extracellular loop 2 region conjugated to KLH |
Rabbit polyclonal anti-SLC25A6 antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from internal of human SLC25A6. |
Rabbit polyclonal anti-ATP5G2 antibody
| Applications | IHC |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from internal of human ATP5G2. |
Rabbit polyclonal anti-MT-ND5 antibody
| Applications | WB |
| Reactivities | Human (Identities = 100%, Positives = 100%) |
| Immunogen | The antiserum was produced against synthesized peptide derived from internal of human MT-ND5. |
Rabbit polyclonal anti-NDUFA3 antibody
| Applications | IHC |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from internal of human NDUFA3. |
Rabbit polyclonal anti-NDUFB1 antibody
| Applications | IHC |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from internal of human NDUFB1. |
Rabbit polyclonal anti-SLC25A31 antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from internal of human SLC25A31. |
Rabbit polyclonal Pael-R (GPR37) Antibody (N-term)
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | This Pael-R (GPR37) antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 97-126 amino acids from the N-terminal region of human Pael-R (GPR37). |
Rabbit Polyclonal Anti-ND6 Antibody
| Applications | WB |
| Reactivities | Human |
| Immunogen | The immunogen for anti-ND6 antibody: synthetic peptide directed towards the middle region of human ND6. Synthetic peptide located within the following region: DGVVVVVNFNSVGSWMIYEGEGSGLIREDPIGAGALYDYGRWLVVVTGWT |
Rabbit Polyclonal Anti-SLC25A4 Antibody
| Applications | IHC |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide of human SLC25A4 |
NDUFA4 rabbit polyclonal antibody, Aff - Purified
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Immunogen | Synthetic peptide, corresponding to amino acids 51-100 of Human NDUFA4. |
ATP5MC1 (Center) rabbit polyclonal antibody, Aff - Purified
| Applications | WB |
| Reactivities | Human, Mouse |
| Immunogen | KLH conjugated synthetic peptide between 27-56 amino acids from the Central region of Human ATP5G1. |
Rabbit Polyclonal Anti-UBE2J2 Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-UBE2J2 antibody: synthetic peptide directed towards the C terminal of human UBE2J2. Synthetic peptide located within the following region: GIQLLNGHAPGAVPNLAGLQQANRHHGLLGGALANLFVIVGFAAFAYTVK |
Rabbit Polyclonal Anti-SLC18A2 Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-SLC18A2 Antibody: synthetic peptide directed towards the N terminal of human SLC18A2. Synthetic peptide located within the following region: NATRDLTLHQTATQHMVTNASAVPSDCPSEDKDLLNENVQVGLLFASKAT |
Rabbit Polyclonal Anti-SLC25A4 Antibody
| Applications | IHC, WB |
| Reactivities | Human, Rat |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-SLC25A4 Antibody: synthetic peptide directed towards the N terminal of human SLC25A4. Synthetic peptide located within the following region: LLQVQHASKQISAEKQYKGIIDCVVRIPKEQGFLSFWRGNLANVIRYFPT |
Rabbit Polyclonal Anti-SLC6A3 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-SLC6A3 Antibody: synthetic peptide directed towards the N terminal of human SLC6A3. Synthetic peptide located within the following region: HCNNSWNSPNCSDAHPGDSSGDSSGLNDTFGTTPAAEYFERGVLHLHQSH |
Rabbit Polyclonal Anti-SLC18A1 Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-SLC18A1 antibody: synthetic peptide directed towards the middle region of human SLC18A1. Synthetic peptide located within the following region: YYLRSPPAKEEKLAILSQDCPMETRMYATQKPTKEFPLGEDSDEEPDHEE |
Active filters
Category
-
Antibodies
- Primary Antibodies
Antibody Hosts
- Rabbit
Families
- Transmembrane
Pathways
- Parkinson's disease
Filter by
Target Symbol
- COX4I1 (8)
- GPR37 (5)
- HTRA2 (4)
- NDUFA4 (4)
- SLC18A1 (4)
- SLC25A4 (4)
- SLC6A3 (4)
- COX7A1 (3)
- COX7A2 (3)
- NDUFA3 (3)
- NDUFC2 (3)
- SLC18A2 (3)
- SLC25A31 (3)
- SLC25A6 (3)
- ATP5MC1 (2)
- ATP5MC2 (2)
- COX4I2 (2)
- COX6C (2)
- MTND5 (2)
- NDUFA1 (2)
- NDUFB5 (2)
- TRPC1 (2)
- UBE2J2 (2)
- ATP5MC3 (1)
- COX6A1 (1)
- COX7A2L (1)
- COX8A (1)
- MTND1 (1)
- MTND6 (1)
- NDUFA4L2 (1)
- NDUFB1 (1)
- NDUFB4 (1)
- SDHC (1)
- UBE2J1 (1)
- UQCR10 (1)