Germany
Japan
United Kingdom
China
Antibodies
Download
USD 515.00
In Stock
Rabbit polyclonal TGFBR2 Antibody (N-term)
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | This TGFBR2 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 13-40 amino acids from the N-terminal region of human TGFBR2. |
IFNAR2 Rabbit Polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human IFNAR2 |
Rabbit Polyclonal Anti-TNFSF14 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-TNFSF14 antibody: synthetic peptide directed towards the middle region of human TNFSF14. Synthetic peptide located within the following region: ATSSSRVWWDSSFLGGVVHLEAGEKVVVRVLDERLVRLRDGTRSYFGAFM |
Rabbit Polyclonal Anti-LEP Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-LEP antibody: synthetic peptide directed towards the N terminal of human LEP. Synthetic peptide located within the following region: MHWGTLCGFLWLWPYLFYVQAVPIQKVQDDTKTLIKTIVTRINDISHTQS |
Rabbit Polyclonal CCR5 Antibody
| Applications | IF, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | CCR5 antibody was raised against a 15 amino acid peptide near the amino terminus of human CCR5. The immunogen is located within the first 50 amino acids of CCR5. |
Rabbit Polyclonal antibody to interferon alpha Receptor 1 (interferon (alpha, beta and omega) receptor 1)
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fragment corresponding to a region within amino acids 3 and 240 of interferon alpha Receptor 1 (Uniprot ID#P17181) |
Rabbit polyclonal CSFR (Ab-809) antibody
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized non-phosphopeptide derived from human CSFR around the phosphorylation site of tyrosine 809 (S-N-YP-I-V). |
Rabbit polyclonal IL8 Antibody (C-term)
| Applications | FC, IF, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This IL8 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 72-99 amino acids from the C-terminal region of human IL8. |
Rabbit anti-PDGFRB Polyclonal Antibody
| Applications | ICC/IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human PDGFRB |
Rabbit anti-EPO Polyclonal Antibody
| Applications | ICC/IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human EPO |
Phospho-KDR-Y1175 Rabbit Polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | A phospho specific peptide corresponding to residues surrounding Y1175 of human KDR |
| Modifications | Phospho-specific |
Rabbit Polyclonal Anti-CXCR4 Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-CXCR4 Antibody: A synthesized peptide derived from human CXCR4 |
Rabbit Polyclonal Antibody against CSF1R
| Applications | FC, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This MCSF Receptor (CSF1R) antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 940-971 amino acids from the C-terminal region of human MCSF Receptor (CSF1R). |
Rabbit Polyclonal DR3 Antibody
| Applications | IF, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | DR3 antibody was raised against a peptide corresponding to amino acids in extracellular domain of human DR3 precusor. The immunogen is located within amino acids 50 - 100 of DR3. |
Rabbit Polyclonal IL-1RAcP Antibody
| Applications | IF, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | IL-1RAcP antibody was raised against a peptide corresponding to amino acids near the carboxy terminus of IL-1RAcP, which differs from the sequence of mouse origin by three amino acids. |
Rabbit Polyclonal IL-21 Receptor Antibody
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | IL-21 receptor antibody was raised against a synthetic peptide corresponding to amino acids 97 to 111 of human IL-21 receptor precursor. The immunogen is located within amino acids 80 - 130 of IL-21 Receptor. |
Rabbit polyclonal antibody to BMPR2 (bone morphogenetic protein receptor, type II (serine/threonine kinase))
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fragment corresponding to a region within amino acids 667 and 951 of BMPR2 (Uniprot ID#Q13873) |
Rabbit Polyclonal antibody to RANKL (tumor necrosis factor (ligand) superfamily, member 11)
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide corresponding to a region within amino acids 253 and 317 of RANKL (Uniprot ID#O14788) |
Rabbit polyclonal IL-9R (Ser519) antibody(Phospho-specific)
| Applications | IF, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human IL-9R around the phosphorylation site of serine 519 (A-R-SP-W-T). |
| Modifications | Phospho-specific |
Rabbit polyclonal anti-CCR2 antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide surrounding to amino acid 353 of rat CCR2 |
Rabbit polyclonal anti-CXCL1 (KC) antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide surrounding amino acid 78 of mouse KC |
Rabbit polyclonal anti-IL-2 antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | IL-2 antibody was prepared from whole rabbit serum produced by repeated immunizations with full length recombinant human IL-2 protein. |
IL2 Rabbit Polyclonal Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human IL2 |
IL1A Rabbit Polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human IL1A |
Rabbit anti-IL28B Polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human IL28B |
Rabbit anti-IFNGR1 Polyclonal Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human IFNGR1 |
Rabbit anti-TNFSF13B Polyclonal Antibody
| Applications | ICC/IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human TNFSF13B |
Active filters
Reactivities
- Human
Antibody Hosts
- Rabbit
Pathways
- Cytokine-cytokine receptor interaction
Filter by
Target Symbol
- EGFR (49)
- AMH (36)
- KDR (23)
- CSF1R (17)
- MET (15)
- PDGFRB (14)
- CXCR4 (13)
- KIT (12)
- FLT1 (11)
- EPOR (10)
- IL4 (10)
- NGFR (10)
- PDGFB (10)
- CCL2 (9)
- CD70 (9)
- TGFBR2 (9)
- TNFRSF11B (9)
- TNFSF13 (9)
- CCR5 (8)
- CCR7 (8)
- LEP (8)
- TGFB2 (8)
- TNF (8)
- TNFSF10 (8)
- TNFSF11 (8)
- VEGFA (8)
- CX3CR1 (7)
- CXCR2 (7)
- CXCR3 (7)
- EDA (7)
- IFNG (7)
- IL2 (7)
- KITLG (7)
- TGFB1 (7)
- TGFBR1 (7)
- TNFRSF10B (7)
- TNFRSF1B (7)
- VEGFB (7)
- ACVR1 (6)
- CCL27 (6)
- CCR8 (6)
- CD40 (6)
- CNTF (6)
- CSF1 (6)
- CX3CL1 (6)
- CXCL1 (6)
- CXCL12 (6)
- EGF (6)
- FAS (6)
- FASLG (6)
- FLT3 (6)
- IL10RA (6)
- IL11RA (6)
- IL17A (6)
- IL18R1 (6)
- IL22RA1 (6)
- IL7 (6)
- IL9 (6)
- PDGFA (6)
- PDGFRA (6)
- TNFRSF1A (6)
- ACVR1B (5)
- BMPR2 (5)
- CCR1 (5)
- CSF2 (5)
- CSF2RA (5)
- CSF3 (5)
- CXCL14 (5)
- HGF (5)
- IFNB1 (5)
- IL12A (5)
- IL1B (5)
- IL21 (5)
- IL2RA (5)
- IL2RB (5)
- IL3 (5)
- INHBA (5)
- PRL (5)
- TNFRSF10A (5)
- TNFRSF21 (5)
- TNFRSF25 (5)
- TNFRSF8 (5)
- TNFSF13B (5)
- TNFSF15 (5)
- TSLP (5)
- ACVR2B (4)
- BMP2 (4)
- CCL28 (4)
- CCR3 (4)
- CTF1 (4)
- CXCL13 (4)
- CXCL8 (4)
- CXCR6 (4)
- EPO (4)
- FLT4 (4)
- GH2 (4)
- GHR (4)
- IFNAR1 (4)
- IFNL3 (4)
- IL10 (4)
Applications
Isotypes
Clonalities
Conjugates
Modifications
Families
- Druggable Genome (1067)
- Transmembrane (708)
- Secreted Protein (572)
- ES Cell Differentiation/IPS (246)
- Protein Kinase (201)
- Adult stem cells (88)
- GPCR (85)
- Cancer stem cells (57)
- Stem cell relevant signaling - JAK/STAT signaling pathway (52)
- Embryonic stem cells (30)
- Transcription Factors (23)
- Induced pluripotent stem cells (17)
- Stem cell - Pluripotency (17)
- Stem cell relevant signaling - TGFb/BMP signaling pathway (8)
- Protease (5)
- Stem cell relevant signaling - DSL/Notch pathway (3)