Rabbit Polyclonal Anti-ACTIN Antibody
Applications | WB |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide of Arabidopsis thaliana actin |
Rabbit Polyclonal Anti-ACTIN Antibody
Applications | WB |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide of Arabidopsis thaliana actin |
Rabbit Polyclonal Anti-MYL2 Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Fusion protein of human MYL2 |
ADCY5 (+ADCY6) rabbit polyclonal antibody, Aff - Purified
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Immunogen | Synthetic peptide, corresponding to amino acids 1111-1160 of Human ADCY 5. |
beta Actin (ACTB) rabbit polyclonal antibody, Purified
Applications | IF, IHC, WB |
Reactivities | Human |
Immunogen | Synthetic human peptide - KLH conjugated |
Integrin alpha 4 (ITGA4) (C-term) rabbit polyclonal antibody, Aff - Purified
Applications | IF, IHC, IP, WB |
Reactivities | Human, Mouse, Rat |
Immunogen | Synthetic peptide corresponding to the C-terminal of human ITGA4 |
TGF beta 1 (TGFB1) (N-term) rabbit polyclonal antibody, Aff - Purified
Applications | IF, IHC, WB |
Reactivities | Human, Mouse |
Immunogen | KLH conjugated synthetic peptide between 22-50 amino acids from the N-terminal region of Human TGFB1. |
IGF1 rabbit polyclonal antibody, Aff - Purified
Applications | ELISA, FN, IHC, WB |
Reactivities | Human |
Immunogen | Highly pure (>98%) recombinant hIGF-1 (human Insulin Like Growth Factor-1) |
Rabbit Polyclonal antibody to alpha Actin (cardiac muscle) (actin, alpha, cardiac muscle 1)
Applications | IF, IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Recombinant fragment contain a sequence corresponding to a region within amino acids 99 and 354 of alpha Actin (cardiac muscle) (Uniprot ID#P68032) |
Rabbit Polyclonal antibody to Integrin alpha 6 (integrin, alpha 6)
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Recombinant fragment corresponding to a region within amino acids 565 and 872 of Integrin alpha 6 (Uniprot ID#P23229) |
Rabbit polyclonal Integrin Beta5 antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from human Integrin β5. |
Rabbit polyclonal Integrin beta1 (Thr789) antibody(Phospho-specific)
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human Integrin β1 around the phosphorylation site of threonine 789 (V-T-TP-V-V). |
Modifications | Phospho-specific |
Rabbit polyclonal Shc (Tyr427) antibody(Phospho-specific)
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human Shc around the phosphorylation site of tyrosine 427 (P-S-YP-V-N). |
Modifications | Phospho-specific |
Rabbit polyclonal Shc (Ab-349) antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized non-phosphopeptide derived from human Shc around the phosphorylation site of tyrosine 349 (H-Q-YP-Y-N). |
Rabbit polyclonal anti-ADCY5/6 antibody
Applications | IF, IHC |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from internal of human ADCY5/6. |
Rabbit polyclonal anti-PRKX antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from internal of human PRKX. |
Rabbit polyclonal anti-NOM1 antibody
Applications | IHC |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from C-terminal of human NOM1. |
Rabbit polyclonal anti-TGF beta2 antibody
Applications | IHC |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from human TGF β2. |
Rabbit polyclonal anti-TGF beta3 antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from human TGF β3. |
GNAS Rabbit Polyclonal (aa385-394) Antibody
Applications | IHC |
Reactivities | Human, Primate |
Conjugation | Unconjugated |
Immunogen | GNAS antibody was raised against synthetic peptide from human GNAS. |
Rabbit polyclonal CACNA2D2 Antibody (Center)
Applications | IF, IHC, WB |
Reactivities | Mouse |
Conjugation | Unconjugated |
Immunogen | This CACNA2D2 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 643-671 amino acids from the Central region of human CACNA2D2. |
Rabbit polyclonal Lamin A (Cleaved-Asp230) antibody
Applications | IHC, WB |
Reactivities | Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from human Lamin A. |
Rabbit polyclonal Lamin A (Cleaved-Asp230) antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from human Lamin A. |
Rabbit Polyclonal Anti-ADRB1 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for Anti-ADRB1 antibody is: synthetic peptide directed towards the C-terminal region of Human ADRB1. Synthetic peptide located within the following region: SDDDDDDVVGATPPARLLEPWAGCNGGAAADSDSSLDEPCRPGFASESKV |
Rabbit anti-ITGB5 Polyclonal Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human ITGB5 |
Rabbit anti-ITGA2B Polyclonal Antibody
Applications | WB |
Reactivities | Mouse, Human |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human ITGA2B |
Rabbit Polyclonal Anti-TPM3 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-TPM3 antibody: synthetic peptide directed towards the middle region of human TPM3. Synthetic peptide located within the following region: TEERAELAESRCREMDEQIRLMDQNLKCLSAAEEKYSQKEDKYEEEIKIL |
Rabbit Polyclonal Anti-CACNG1 Antibody - N-terminal region
Applications | WB |
Reactivities | Mouse |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-Cacng1 antibody: synthetic peptide corresponding to a region of Mouse. Synthetic peptide located within the following region: AVHNKDKSCEHVTPSGEKNCSYFRHFNPGESSEIFEFTTQKEYSISAAAI |
Rabbit Polyclonal Anti-PRKACA Antibody - N-terminal region
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-PRKACA antibody: synthetic peptide directed towards the N terminal of human PRKACA. Synthetic peptide located within the following region: MASNSSDVKEFLAKAKEDFLKKWESPAQNTAHLDQFERIKTLGTGSFGRV |
Rabbit Polyclonal Anti-PRKACA Antibody - N-terminal region
Applications | WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-PRKACA antibody: synthetic peptide directed towards the N terminal of human PRKACA. Synthetic peptide located within the following region: MASNSSDVKEFLAKAKEDFLKKWESPAQNTAHLDQFERIKTLGTGSFGRV |
Rabbit Polyclonal Anti-PARVG Antibody - N-terminal region
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for Anti-PARVG antibody is: synthetic peptide directed towards the N-terminal region of Human PARVG. Synthetic peptide located within the following region: RKDPKFEELQKVLMEWINATLLPEHIVVRSLEEDMFDGLILHHLFQRLAA |
Rabbit Polyclonal Anti-Myh7 Antibody
Applications | IHC |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-Myh7 antibody: synthetic peptide corresponding to a region of Mouse. Synthetic peptide located within the following region: TLEDQMNEHRSKAEETQRSVNDLTSQRAKLQTENGELSRQLDEKEALISQ |
Rabbit Polyclonal Anti-MYL3 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-MYL3 antibody: synthetic peptide directed towards the N terminal of human MYL3. Synthetic peptide located within the following region: VEFDASKIKIEFTPEQIEEFKEAFMLFDRTPKCEMKITYGQCGDVLRALG |
Rabbit Polyclonal Anti-GNAS Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-GNAS antibody: synthetic peptide directed towards the C terminal of human GNAS. Synthetic peptide located within the following region: YFPEFARYTTPEDATPEPGEDPRVTRAKYFIRDEFLRISTASGDGRHYCY |
Rabbit Polyclonal Anti-Actin-pan Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-Actin-pan Antibody: A synthesized peptide derived from human Actin-pan |
Rabbit Polyclonal Anti-Desmin Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-Desmin Antibody: A synthesized peptide derived from human Desmin |
Rabbit Polyclonal Anti-Integrin beta-5 Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-Integrin beta-5 Antibody: A synthesized peptide derived from human Integrin beta-5 |
Rabbit Polyclonal Anti-KAPC A/B Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-KAPC A/B Antibody: A synthesized peptide derived from human KAPC A/B |
Rabbit Polyclonal Anti-TGF beta1 Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-TGF beta1 Antibody: The antiserum was produced against synthesized peptide derived from human TGF beta. |
Rabbit Polyclonal Anti-Integrin aV Antibody
Applications | WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-Integrin aV Antibody: A synthesized peptide derived from human Integrin aV |
Rabbit Polyclonal Anti-Integrin a3 (CD49c) Antibody
Applications | WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-Integrin a3 (CD49c) Antibody: A synthesized peptide |
Rabbit Polyclonal Anti-Integrin β4 Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-Integrin β4 Antibody: A synthesized peptide derived from human Integrin β4 |
Rabbit Polyclonal Anti-Integrin β1 Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-Integrin β1 Antibody: A synthesized peptide derived from human Integrin β1 |
Rabbit Polyclonal Anti-IGF1 antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-IGF1 antibody: A synthesized peptide derived from human IGF1 |
Rabbit Polyclonal Anti-Beta actin antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-Beta actin antibody: A synthesized peptide derived from human Beta actin |
Rabbit Polyclonal Anti-CACNB1 Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Fusion protein of human CACNB1 |
Rabbit anti Dystrophin Polyclonal Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | A synthetic peptide corresponding to the intra domain 410-450aa of human Dystrophin protein. This sequence is identical to mouse and Pan troglodytes and other species. |
Rabbit Polyclonal Integrin alpha 6 Antibody
Applications | ELISA, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | DNA immunization. This antibody is specific for the Middle Region of the target protein. |
Rabbit Polyclonal CACNB2 Antibody
Applications | ELISA, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | DNA immunization. This antibody is specific for the C Terminus Region of the target protein. |
CDX2 rabbit monoclonal antibody, clone EPR2764Y, Supernatant
Applications | IF, IHC, WB |
Reactivities | Human |
CD61 (ITGB3) rabbit polyclonal antibody, Aff - Purified
Applications | ELISA, IHC |
Reactivities | Human, Mouse |
Immunogen | Synthetic peptide, corresponding to amino acids 741-790 of Human Integrin β3. |