Antibodies

View as table Download

Anti-EXT1 Rabbit Polyclonal Antibody

Applications IF, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein corresponding to C terminal 280 amino acids of human exostosin glycosyltransferase 1

EXT1 Rabbit Polyclonal Antibody

Applications ICC/IF, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant protein of human EXT1

Rabbit Polyclonal Anti-DENR Antibody

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen DENR antibody was raised against an 18 amino acid peptide near the center of human DENR.

Rabbit polyclonal EXT2 Antibody (Center)

Applications FC, IF, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen This EXT2 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 182-209 amino acids from the Central region of human EXT2.

Rabbit Polyclonal Antibody against HS2ST1

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen This HS2ST1 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 16-45 amino acids from the N-terminal region of human HS2ST1.

Rabbit Polyclonal Anti-HS3ST1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-HS3ST1 Antibody: synthetic peptide directed towards the middle region of human HS3ST1. Synthetic peptide located within the following region: TKGFYCLRDSGRDRCLHESKGRAHPQVDPKLLNKLHEYFHEPNKKFFELV

Rabbit Polyclonal Anti-HS2ST1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-HS2ST1 antibody: synthetic peptide directed towards the N terminal of human HS2ST1. Synthetic peptide located within the following region: GLLRIMMPPKLQLLAVVAFAVAMLFLENQIQKLEESRSKLERAIARHEVR

Rabbit Polyclonal Anti-HS2ST1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-HS2ST1 antibody: synthetic peptide directed towards the middle region of human HS2ST1. Synthetic peptide located within the following region: GVTEELEDFIMLLEAALPRFFRGATELYRTGKKSHLRKTTEKKLPTKQTI

EXTL3 (N-term) rabbit polyclonal antibody, Aff - Purified

Applications FC, IHC, WB
Reactivities Human
Immunogen KLH conjugated synthetic peptide between 50~80 amino acids from the N-terminal region of human EXTL3

HS3ST2 (C-term) rabbit polyclonal antibody, Aff - Purified

Applications FC, IHC, WB
Reactivities Human
Immunogen KLH conjugated synthetic peptide between 324~354 amino acids from the C-terminal region of Human HS3ST2

Rabbit Polyclonal Anti-XYLT2 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-XYLT2 antibody: synthetic peptide directed towards the middle region of human XYLT2. Synthetic peptide located within the following region: PMGTPLCRFEPRGLPSSVHLYFYDDHFQGYLVTQAVQPSAQGPAETLEMW

Rabbit Polyclonal Anti-XYLT2 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-XYLT2 antibody: synthetic peptide directed towards the C terminal of human XYLT2. Synthetic peptide located within the following region: LRPGPWTVRLLQFWEPLGETRFLVLPLTFNRKLPLRKDDASWLHAGPPHN

Rabbit Polyclonal Anti-B3GAT1 Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide of human B3GAT1

EXTL3 (N-term) rabbit polyclonal antibody, Aff - Purified

Applications IHC, WB
Reactivities Human
Immunogen KLH conjugated synthetic peptide between 352-382 amino acids from the N-terminal region of human EXTL3

Rabbit Polyclonal CD57 Antibody

Applications IHC
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen A synthetic peptide made to a C-terminal portion of the human CD57 protein (between residues 250-300) [UniProt Q9P2W7]

Rabbit anti-B3GAT1 polyclonal antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Synthetic peptide derived from Human CD57.

Rabbit Polyclonal beta-1,3-Glucuronyltransferase 1/B3GAT1/CD57 Antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen A synthetic peptide made to an N-terminal portion of the human CD57 protein (between residues 1-50) [UniProt Q9P2W7]

B3GAT2 (Center) rabbit polyclonal antibody, Aff - Purified

Applications WB
Reactivities Human, Mouse
Immunogen KLH conjugated synthetic peptide between 130-158 amino acids from the Central region of human B3GAT2

B3GAT3 (C-term) rabbit polyclonal antibody, Aff - Purified

Applications WB
Reactivities Human
Immunogen KLH conjugated synthetic peptide between 300-329 amino acids from the C-terminal region of human B3GAT3

EXT1 (Center) rabbit polyclonal antibody, Aff - Purified

Applications WB
Reactivities Human
Immunogen KLH conjugated synthetic peptide between 297-326 amino acids from the Central region of Human EXT1

EXTL2 (C-term) rabbit polyclonal antibody, Aff - Purified

Applications WB
Reactivities Human, Mouse
Immunogen KLH conjugated synthetic peptide between 280~310 amino acids from the C-terminal region of human EXTL2.

XYLT1 (N-term) rabbit polyclonal antibody, Aff - Purified

Applications WB
Reactivities Human
Immunogen KLH conjugated synthetic peptide between 133-163 amino acids from the N-terminal region of human XYLT1

Rabbit polyclonal Anti-HS6ST3 Antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-HS6ST3 antibody: synthetic peptide directed towards the C terminal of human HS6ST3. Synthetic peptide located within the following region: TKQLEHQRDRQKRREERRLQREHRDHQWPKEDGAAEGTVTEDYNSQVVRW

Rabbit polyclonal Anti-HS3ST5 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-HS3ST5 antibody: synthetic peptide directed towards the C terminal of human HS3ST5. Synthetic peptide located within the following region: SQYNLYFNATRGFYCLRFNIIFNKCLAGSKGRIHPEVDPSVITKLRKFFH

Rabbit Polyclonal Anti-B3GAT1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-B3GAT1 antibody is: synthetic peptide directed towards the N-terminal region of Human B3GAT1. Synthetic peptide located within the following region: LAPLLAVHKDEGSDPRRETPPGADPREYCTSDRDIVEVVRTEYVYTRPPP

Rabbit Polyclonal Anti-EXT2 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-EXT2 antibody: synthetic peptide directed towards the N terminal of human EXT2. Synthetic peptide located within the following region: NELLMAISDSDYYTDDINRACLFVPSIDVLNQNTLRIKETAQAMAQLSRW

Rabbit Polyclonal Anti-HS6ST2 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-HS6ST2 Antibody is: synthetic peptide directed towards the C-terminal region of Human HS6ST2. Synthetic peptide located within the following region: QNPNPNANQNLTQNLMQNLTQSLSQKENRESPKQNSGKEQNDNTSNGTND

Rabbit Polyclonal Anti-XYLT1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-XYLT1 antibody: synthetic peptide directed towards the middle region of human XYLT1. Synthetic peptide located within the following region: RITNWNRKLGCKCQYKHIVDWCGCSPNDFKPQDFHRFQQTARPTFFARKF

Rabbit Polyclonal Anti-NDST4 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-NDST4 antibody: synthetic peptide directed towards the N terminal of human NDST4. Synthetic peptide located within the following region: EDWTIFQYNHSTYQPVLLTELQTEKSLSSLSSKTLFATVIQDLGLHDGIQ

Rabbit Polyclonal Anti-NDST4 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-NDST4 antibody: synthetic peptide directed towards the middle region of human NDST4. Synthetic peptide located within the following region: YLFLLMHPSIISNLPSPKTFEEVQFFNGNNYHKGIDWYMDFFPTPSNTTS

Rabbit Polyclonal Anti-HS3ST3B1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-HS3ST3B1 antibody: synthetic peptide directed towards the N terminal of human HS3ST3B1. Synthetic peptide located within the following region: AMLCVWLYMFLYSCAGSCAAAPGLLLLGSGSRAAHDPPALATAPDGTPPR

Rabbit Polyclonal Anti-NDST3 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-NDST3 antibody: synthetic peptide directed towards the N terminal of human NDST3. Synthetic peptide located within the following region: PGTDWTVFQINHSAYQPVIFAKVKTPENLSPSISKGAFYATIIHDLGLHD

Rabbit Polyclonal Anti-B3GAT3 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-B3GAT3 antibody: synthetic peptide directed towards the N terminal of human B3GAT3. Synthetic peptide located within the following region: PPLRAAAEQLRQKDLRISQLQAELRRPPPAPAQPPEPEALPTIYVVTPTY

Rabbit Polyclonal Anti-B3GALT6 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-B3GALT6 antibody: synthetic peptide directed towards the N terminal of human B3GALT6. Synthetic peptide located within the following region: EREQARHGDLLLLPALRDAYENLTAKVLAMLAWLDEHVAFEFVLKADDDS

Rabbit Polyclonal Anti-B3GALT6 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-B3GALT6 antibody: synthetic peptide directed towards the C terminal of human B3GALT6. Synthetic peptide located within the following region: VQREHDPRFDTEYRSRGCSNQYLVTHKQSLEDMLEKHATLAREGRLCKRE

Rabbit Polyclonal Anti-EXTL3 Antibody

Applications IHC
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Fusion protein of human EXTL3

Rabbit Polyclonal Anti-EXTL1 Antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide of human EXTL1

HS6ST1 Antibody - C-terminal region

Applications WB
Reactivities Human
Conjugation Unconjugated