Rabbit monoclonal anti-RFA2 antibody for SISCAPA, clone OTIR2G2
Applications | SISCAPA |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Rabbit monoclonal anti-RFA2 antibody for SISCAPA, clone OTIR2G2
Applications | SISCAPA |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
MSH6 Rabbit Polyclonal Antibody
Applications | ICC/IF, IHC, WB |
Reactivities | Human, Mouse, Rat, Monkey |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human MSH6 |
Rabbit Polyclonal Anti-MSH6 Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-MSH6 antibody: synthetic peptide directed towards the N terminal of human MSH6. Synthetic peptide located within the following region: ISDSESDIGGSDVEFKPDTKEEGSSDEISSGVGDSESEGLNSPVKVARKR |
Rabbit anti-RPA2 Polyclonal Antibody
Applications | ChIP, IHC, IP, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human RPA2 |
LIG1 Rabbit Polyclonal Antibody
Applications | ICC/IF, IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human LIG1 |
Rabbit polyclonal anti-MtSSB antibody
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from internal of human MtSSB. |
RFC1 Rabbit Polyclonal Antibody
Applications | ICC/IF, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human RFC1 |
Rabbit anti-POLD1 Polyclonal Antibody
Applications | ICC/IF, IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human POLD1 |
Rabbit Polyclonal Anti-MLH1 Antibody
Applications | IHC |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Fusion protein of human MLH1 |
Rabbit Polyclonal antibody to RPA70 (replication protein A1, 70kDa)
Applications | IF, IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Recombinant fragment corresponding to a region within amino acids 369 and 616 of RPA70 (Uniprot ID#P27694) |
Rabbit polyclonal anti-PCNA antibody, Loading control
Applications | WB |
Reactivities | Human, Mouse, Rat, Monkey |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human PCNA |
Rabbit Polyclonal PCNA Antibody
Applications | ELISA, IHC, WB |
Reactivities | Human, Monkey, Mouse, Rat, Dog |
Conjugation | Unconjugated |
Immunogen | DNA immunization. This antibody is specific for the Middle Region of the target protein. |
MSH2 Rabbit Polyclonal Antibody
Applications | IF, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human MSH2 |
Rabbit monoclonal antibody against MLH1(clone EPR3893)
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Rabbit polyclonal anti-PCNA antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from human PCNA. |
Rabbit polyclonal PCNA Antibody (Center)
Applications | FC, IF, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | This PCNA antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 89-117 amino acids from the Central region of human PCNA. |
Rabbit Polyclonal Anti-PCNA Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-PCNA Antibody: A synthesized peptide derived from human PCNA |
Rabbit Polyclonal antibody to RFC4 (replication factor C (activator 1) 4, 37kDa)
Applications | IF, IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Recombinant fragment corresponding to a region within amino acids 18 and 323 of RFC4 (Uniprot ID#P35249) |
Rabbit polyclonal anti-MLH1 antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from internal of human MLH1. |
Rabbit polyclonal RFA2 (Ab-21) antibody
Applications | WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized non-phosphopeptide derived from human RFA2 around the phosphorylation site of threonine 21 (G-Y-TP-Q-S). |
Rabbit polyclonal anti-RFC2 antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from internal of human RFC2. |
Rabbit polyclonal anti-MSH6 antibody
Applications | WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from internal of human MSH6. |
Anti-MSH6 Rabbit Polyclonal Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Fusion protein corresponding to C terminal 300 amino acids of human mutS homolog 6 (E. coli) |
Rabbit Polyclonal RFA2 Antibody
Applications | WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against A synthesized peptide derived from human RFA2 |
Rabbit Polyclonal RFA2 (Thr21) Antibody (Phospho-specific)
Applications | WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against A synthesized peptide derived from human RFA2 around the phosphorylation site of Threonine 21 |
Modifications | Phospho-specific |
Rabbit polyclonal anti-POLD1 antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from internal of human POLD1. |
Rabbit polyclonal RFA2 (Thr21) antibody(Phospho-specific)
Applications | IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human RFA2 around the phosphorylation site of threonine 21 (G-Y-TP-Q-S). |
Modifications | Phospho-specific |
Rabbit polyclonal anti-MSH2 antibody
Applications | IF, IHC |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from internal of human MSH2. |
Anti-RPA1 Rabbit Polyclonal Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Fusion protein corresponding to C terminal 250 amino acids of human replication protein A1, 70kDa |
Rabbit polyclonal Anti-MLH1 Antibody
Applications | WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-MLH1 antibody: synthetic peptide directed towards the N terminal of human MLH1. Synthetic peptide located within the following region: MIENCLDAKSTSIQVIVKEGGLKLIQIQDNGTGIRKEDLDIVCERFTTSK |
Rabbit polyclonal RFA2 (Ser33) antibody(Phospho-specific)
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human RFA2 around the phosphorylation site of serine 33 (A-P-SP-Q-A). |
Modifications | Phospho-specific |
Rabbit polyclonal anti-POLD3 antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from internal of human POLD3. |
Rabbit polyclonal anti-PCNA antibody
Applications | WB |
Reactivities | Bovine, Chicken, Fish, Human, Monkey, Mouse, Rat, Xenopus, Dog |
Conjugation | Unconjugated |
Immunogen | This affinity purified antibody was prepared from whole rabbit serum produced by repeated immunizations with a synthetic peptide corresponding to an internal region of human PCNA protein. |
Rabbit polyclonal POLD2 Antibody (Center)
Applications | WB |
Reactivities | Human, Rat |
Conjugation | Unconjugated |
Immunogen | This POLD2 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 237-265 amino acids from the Central region of human POLD2. |
Anti-PCNA Rabbit Polyclonal Antibody
Applications | ELISA, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Fusion protein corresponding to a region derived from 9-252 amino acids of Human Proliferating cell nuclear antigen |
Anti-MSH3 Rabbit Polyclonal Antibody
Applications | IHC |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Fusion protein corresponding to a C terminal 300 amino acids of human mutS homolog 3 (E. coli) |
Anti-PMS2 Rabbit Polyclonal Antibody
Applications | IHC |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide corresponding to a region derived from 638-650 amino acids of Human PMS2 postmeiotic segregation increased 2 (S. cerevisiae) |
Anti-PMS2 Rabbit Polyclonal Antibody
Applications | IHC |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide corresponding to a region derived from 638-650 amino acids of Human PMS2 postmeiotic segregation increased 2 (S. cerevisiae) |
Rabbit Polyclonal Anti-LIG1 Antibody
Applications | IHC |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Fusion protein of human LIG1 |
Rabbit Polyclonal Anti-SSBP1 Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Fusion protein of human SSBP1 |
Rabbit polyclonal anti-RFC2 Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human RFC2 |
Rabbit polyclonal anti-RFC2 Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human RFC2 |
Rabbit Polyclonal anti-RFC3 Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human RFC3 |
Rabbit Polyclonal anti-RFC3 Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human RFC3 |